BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00280 (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 1.5 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 3.4 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 501 ALCAASTSVAESNSGRPWYPRCTLQRDGAI*TSRF--IGTWSGLPRCWGCSC 650 A+C +TS+ ESN P +C SRF +G C C+C Sbjct: 730 AICVNATSLVESNRNVP--QKCIFNGQAYFPGSRFHPFLIPTGFDSCTVCTC 779 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -1 Query: 556 YQGRPELDSATLVLAAQSAIIFNVLQQL 473 +Q PEL+ L + S++ FN+ Q+ Sbjct: 160 FQNLPELEDLDLAYNSISSLDFNIFDQV 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,174 Number of Sequences: 336 Number of extensions: 3564 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -