BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00276 (751 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) 47 1e-05 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_229| Best HMM Match : Ribosomal_L19 (HMM E-Value=4.9) 46 4e-05 SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 45 6e-05 SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) 45 8e-05 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 45 8e-05 SB_38578| Best HMM Match : RVT_1 (HMM E-Value=0.018) 45 8e-05 SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) 45 8e-05 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 45 8e-05 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 45 8e-05 SB_28146| Best HMM Match : Na_Ca_ex (HMM E-Value=0.039) 45 8e-05 SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) 45 8e-05 SB_16993| Best HMM Match : RVT_1 (HMM E-Value=0.35) 45 8e-05 SB_7284| Best HMM Match : F5_F8_type_C (HMM E-Value=7.3e-10) 45 8e-05 SB_3080| Best HMM Match : Methylase_S (HMM E-Value=2.6) 45 8e-05 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 44 2e-04 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 43 3e-04 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 43 3e-04 SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) 43 3e-04 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 43 3e-04 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 43 3e-04 SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) 43 3e-04 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 43 3e-04 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 43 3e-04 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 43 3e-04 SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13) 43 3e-04 SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) 43 3e-04 SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) 42 4e-04 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 42 4e-04 SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) 42 5e-04 SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) 42 5e-04 SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) 42 7e-04 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 41 0.001 SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 41 0.001 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) 41 0.001 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 41 0.001 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 41 0.001 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 40 0.002 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 40 0.002 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 40 0.002 SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) 40 0.002 SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 40 0.002 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 40 0.002 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 40 0.002 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) 40 0.002 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) 40 0.002 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.003 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.003 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 39 0.004 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.004 SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 39 0.004 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.004 SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.004 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 39 0.004 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 39 0.004 SB_22397| Best HMM Match : DAO (HMM E-Value=7.6e-06) 39 0.004 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 39 0.004 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 39 0.004 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 39 0.004 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 39 0.004 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.004 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 39 0.005 SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) 39 0.005 SB_32049| Best HMM Match : RVT_1 (HMM E-Value=6.7e-15) 39 0.005 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 39 0.005 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 39 0.005 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 39 0.005 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 39 0.005 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 39 0.005 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 38 0.007 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.007 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 38 0.007 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.007 SB_21018| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.007 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 38 0.007 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.007 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.007 SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.007 SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) 38 0.007 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.007 SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1234| Best HMM Match : RVT_1 (HMM E-Value=3.1e-08) 38 0.009 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 38 0.011 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.011 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_40030| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 38 0.011 SB_33916| Best HMM Match : Hormone_2 (HMM E-Value=8.8) 38 0.011 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 38 0.011 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 37 0.015 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.015 SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) 37 0.015 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.015 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 37 0.015 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 37 0.015 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 37 0.015 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) 37 0.015 SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_12448| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) 37 0.020 SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) 37 0.020 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 37 0.020 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) 37 0.020 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 37 0.020 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 36 0.027 SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_3609| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) 36 0.027 SB_20736| Best HMM Match : DUF1628 (HMM E-Value=9.4) 36 0.035 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 36 0.035 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 36 0.035 SB_58475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_50245| Best HMM Match : RVT_1 (HMM E-Value=1.4e-16) 36 0.046 SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_56177| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_34598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) 36 0.046 SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) 36 0.046 SB_55916| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.061 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 35 0.061 SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 35 0.061 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 35 0.061 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 35 0.061 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 35 0.061 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.061 SB_21896| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_21856| Best HMM Match : RVT_1 (HMM E-Value=4.5e-32) 35 0.081 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.081 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 34 0.11 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.11 SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_44863| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_38467| Best HMM Match : RVT_1 (HMM E-Value=4.2e-05) 34 0.11 SB_44245| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 34 0.14 SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) 34 0.14 SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) 34 0.14 SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) 34 0.14 SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 34 0.14 SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_34652| Best HMM Match : Ank (HMM E-Value=3.8e-34) 34 0.14 SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) 34 0.14 SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23) 34 0.14 SB_19953| Best HMM Match : Trehalase (HMM E-Value=0.66) 34 0.14 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 34 0.14 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_51319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_36141| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_7055| Best HMM Match : RVT_1 (HMM E-Value=0.00051) 33 0.19 SB_59586| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_43683| Best HMM Match : RVT_1 (HMM E-Value=0.024) 33 0.25 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 33 0.25 SB_57531| Best HMM Match : RVT_1 (HMM E-Value=2.9e-10) 33 0.25 SB_51811| Best HMM Match : Vicilin_N (HMM E-Value=1.9) 33 0.25 SB_45694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_38694| Best HMM Match : RVT_1 (HMM E-Value=3.8e-09) 33 0.25 SB_18340| Best HMM Match : Vicilin_N (HMM E-Value=1.5) 33 0.25 SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) 33 0.25 SB_2303| Best HMM Match : RVT_1 (HMM E-Value=7.9e-11) 33 0.25 SB_54431| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3) 33 0.33 SB_35790| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_21602| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 33 0.33 SB_15009| Best HMM Match : TP2 (HMM E-Value=3.3) 33 0.33 SB_9500| Best HMM Match : Saccharop_dh_N (HMM E-Value=1.8) 33 0.33 SB_5231| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_5046| Best HMM Match : GST_N (HMM E-Value=2.5e-05) 33 0.33 SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) 33 0.33 SB_59564| Best HMM Match : Vicilin_N (HMM E-Value=4.8) 33 0.33 SB_53833| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_43442| Best HMM Match : BNR (HMM E-Value=0.00033) 33 0.33 SB_42770| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_16475| Best HMM Match : Vicilin_N (HMM E-Value=1.6) 33 0.33 SB_12419| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 33 0.33 SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.43 SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_42670| Best HMM Match : RVT_1 (HMM E-Value=5.6e-27) 32 0.43 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.43 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 32 0.43 SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_30073| Best HMM Match : RVT_1 (HMM E-Value=3e-26) 32 0.43 SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5) 32 0.43 SB_21609| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7) 32 0.43 SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_12043| Best HMM Match : RVT_1 (HMM E-Value=3.1) 32 0.43 SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) 32 0.43 SB_567| Best HMM Match : RVT_1 (HMM E-Value=8.3e-05) 32 0.43 SB_58606| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_40027| Best HMM Match : RVT_1 (HMM E-Value=3.8e-11) 32 0.43 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.43 SB_34517| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) 32 0.43 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.43 SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 32 0.43 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) 32 0.43 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.43 SB_19635| Best HMM Match : Met_10 (HMM E-Value=3.4e-13) 32 0.43 SB_16012| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) 32 0.43 SB_13896| Best HMM Match : bZIP_1 (HMM E-Value=3.6) 32 0.43 SB_534| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 32 0.43 SB_15987| Best HMM Match : RVT_1 (HMM E-Value=3.7e-27) 32 0.57 SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) 32 0.57 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 32 0.57 SB_51050| Best HMM Match : DUF1168 (HMM E-Value=1) 32 0.57 SB_7145| Best HMM Match : RVT_1 (HMM E-Value=3.8e-25) 32 0.57 SB_45963| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) 31 0.76 SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 31 0.76 SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2) 31 0.76 SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) 31 0.76 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 31 0.76 SB_37537| Best HMM Match : Vicilin_N (HMM E-Value=1) 31 0.76 SB_32390| Best HMM Match : Vicilin_N (HMM E-Value=0.3) 31 0.76 SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) 31 0.76 SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) 31 0.76 SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) 31 1.00 SB_39791| Best HMM Match : RVT_1 (HMM E-Value=0.083) 31 1.00 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 31 1.00 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_21594| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_21074| Best HMM Match : NadA (HMM E-Value=2) 31 1.00 SB_2270| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 31 1.00 SB_58486| Best HMM Match : Vicilin_N (HMM E-Value=1.6) 31 1.00 SB_55189| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_47186| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 31 1.00 SB_43228| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_32455| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_7760| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7) 31 1.00 SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) 31 1.3 SB_40349| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) 31 1.3 SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 31 1.3 SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 31 1.3 SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 31 1.3 SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) 31 1.3 SB_15188| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) 31 1.3 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 31 1.3 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 31 1.3 SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 31 1.3 SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 31 1.3 SB_31451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_23576| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_20463| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 31 1.3 SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) 31 1.3 SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) 31 1.3 SB_5882| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) 31 1.3 SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) 31 1.3 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 30 1.7 SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 30 1.7 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 30 1.7 SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22) 30 2.3 SB_55265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24) 30 2.3 SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) 30 2.3 SB_32784| Best HMM Match : RVT_1 (HMM E-Value=3.9e-26) 30 2.3 SB_29894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_29413| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 30 2.3 SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 30 2.3 SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42) 30 2.3 SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096) 29 3.0 SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) 29 3.0 SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 29 3.0 SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 29 3.0 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 29 3.0 SB_13918| Best HMM Match : RVT_1 (HMM E-Value=5.2e-07) 29 3.0 SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) 29 3.0 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 29 3.0 SB_51607| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_39518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 29 3.0 SB_10516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 29 3.0 SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 29 3.0 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 29 4.0 SB_39529| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_28679| Best HMM Match : RVT_1 (HMM E-Value=9.3e-08) 29 4.0 SB_2306| Best HMM Match : MecA_N (HMM E-Value=2.3) 29 4.0 SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35) 29 5.3 SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 29 5.3 SB_23604| Best HMM Match : RVT_1 (HMM E-Value=4.6e-13) 29 5.3 SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) 29 5.3 SB_15533| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) 28 7.0 SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 28 7.0 SB_36682| Best HMM Match : RVT_1 (HMM E-Value=0.0067) 28 7.0 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 28 7.0 SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15) 28 7.0 SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) 28 7.0 SB_58243| Best HMM Match : DUF584 (HMM E-Value=1.5) 28 7.0 SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) 28 7.0 SB_55170| Best HMM Match : RVT_1 (HMM E-Value=0.16) 28 7.0 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 28 7.0 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 28 7.0 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_44847| Best HMM Match : RVT_1 (HMM E-Value=0.00042) 28 7.0 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) 28 7.0 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 28 7.0 SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_23528| Best HMM Match : RVT_1 (HMM E-Value=0.00042) 28 7.0 SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) 28 7.0 SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) 28 7.0 SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) 28 9.3 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 28 9.3 SB_5693| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_96| Best HMM Match : RVT_1 (HMM E-Value=0.00075) 28 9.3 SB_49126| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_48616| Best HMM Match : RVT_1 (HMM E-Value=2.8e-26) 28 9.3 SB_44871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 50.8 bits (116), Expect = 1e-06 Identities = 31/86 (36%), Positives = 43/86 (50%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R +H C E L + + L K T L D +KAFD V H+ L+ KL + G+S + Sbjct: 608 RERHFC-ETQLLLTYNDLALAMDKKQQTDLLLLDFSKAFDSVSHSRLLIKLQHYGISGQV 666 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRPRI 512 + DFL NR+ V+G S P I Sbjct: 667 YYWLEDFLKNRTQSVVVDGEHSSPAI 692 >SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLT-EHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R +HSC+ LT + + ++K++ T L D +KAFD V H+ L+ KL + G+S Sbjct: 206 RERHSCETQLLLTFNDLALAMDKKQ--QTDLLLLDFSKAFDSVSHSRLLIKLQHYGISGQ 263 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 + + DF NR+ V+G S P I Sbjct: 264 VYYWLEDFFKNRTQSVVVDGEHSSPAI 290 >SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.8 bits (111), Expect = 5e-06 Identities = 30/84 (35%), Positives = 43/84 (51%) Frame = +3 Query: 261 KHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVL 440 +HSC E L + + L K T L D +KAFD V ++ L+ KL + G+S + Sbjct: 3 RHSC-ETQLLLTYNDLALAMDKKQQTDLLLLDFSKAFDSVSNSRLLIKLQHYGISGQVYY 61 Query: 441 IIRDFLSNRSFPYRVEGTRSRPRI 512 + DFL NR+ V+G S P I Sbjct: 62 WLEDFLKNRTQSVVVDGEHSSPAI 85 >SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 48.4 bits (110), Expect = 6e-06 Identities = 31/86 (36%), Positives = 42/86 (48%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R +HSC E L + + L K T L D +KAFD V H L+ KL + +S + Sbjct: 400 RERHSC-ETQLLLTYNDLALAMDKKQQTDLLLLDFSKAFDSVSHLRLLIKLQHYEISGQV 458 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRPRI 512 + DFL NR+ V+G S P I Sbjct: 459 YYWLEDFLKNRTQSVVVDGEHSSPAI 484 >SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) Length = 326 Score = 47.2 bits (107), Expect = 1e-05 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 64 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 118 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + L+ KL G S+ + ++R + +NR ++ Sbjct: 119 LAVDSKQFI--GILSTDMSKAFDSLHPEPLVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 176 Query: 486 EGTRS 500 G S Sbjct: 177 NGVTS 181 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 46.4 bits (105), Expect = 2e-05 Identities = 39/137 (28%), Positives = 68/137 (49%), Gaps = 4/137 (2%) Frame = +3 Query: 102 YNTTITILR---YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSC 272 + +T+LR YRPI+LL +D+ + + T + H D +D R KHSC Sbjct: 478 FTKRMTVLREKNYRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSC 532 Query: 273 KEVHC-LTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIR 449 + LTE + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R Sbjct: 533 ETTLLKLTEDWKLAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMR 590 Query: 450 DFLSNRSFPYRVEGTRS 500 + +NR ++ G S Sbjct: 591 SYFTNRQNRVKLNGVTS 607 >SB_229| Best HMM Match : Ribosomal_L19 (HMM E-Value=4.9) Length = 229 Score = 45.6 bits (103), Expect = 4e-05 Identities = 28/73 (38%), Positives = 34/73 (46%) Frame = +3 Query: 282 HCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLS 461 H LT IE KR L P F D+ KAFD V H ++ L +GV L+ IRD + Sbjct: 149 HVLTIRSIIEGAKRDLKPLHMAFVDVKKAFDSVSHETVVIALQRLGVPSPLISYIRDLYN 208 Query: 462 NRSFPYRVEGTRS 500 S G RS Sbjct: 209 RSSTILEFAGCRS 221 >SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 45.6 bits (103), Expect = 4e-05 Identities = 28/73 (38%), Positives = 34/73 (46%) Frame = +3 Query: 282 HCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLS 461 H LT IE KR L P F D+ KAFD V H ++ L +GV L+ IRD + Sbjct: 90 HVLTIRSIIEGAKRDLKPLHMAFVDVKKAFDSVSHETVVIALQRLGVPSPLISYIRDLYN 149 Query: 462 NRSFPYRVEGTRS 500 S G RS Sbjct: 150 RSSTILEFAGCRS 162 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 45.2 bits (102), Expect = 6e-05 Identities = 37/124 (29%), Positives = 60/124 (48%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*I 308 YRPISL + ++ ++ ++ HL + D + + R SC+ L E + Sbjct: 455 YRPISLTCICSKL-LEHIITKNIVS-HL-EHHDILYKFQHGFRKLRSCESQ--LIEFVND 509 Query: 309 ELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVE 488 L + T + D +KAFDKV HN L+YKL G+ +++ I FL +R V+ Sbjct: 510 ILGNSRAKQTDVIIMDFSKAFDKVPHNRLLYKLERCGIRGDVLMWIGSFLKHRQQSVVVD 569 Query: 489 GTRS 500 G +S Sbjct: 570 GEQS 573 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +3 Query: 354 DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 D +KAFDKV HN L+YKL G+ +++ I FL +R V+G +S Sbjct: 2 DFSKAFDKVPHNRLLYKLERCGIRGDVLMWIGSFLKHRQQSVVVDGEQS 50 >SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) Length = 575 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 313 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 367 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 368 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 425 Query: 486 EGTRS 500 G S Sbjct: 426 NGVTS 430 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 119 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 173 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 174 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 231 Query: 486 EGTRS 500 G S Sbjct: 232 NGVTS 236 >SB_38578| Best HMM Match : RVT_1 (HMM E-Value=0.018) Length = 472 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 241 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 295 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 296 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 353 Query: 486 EGTRS 500 G S Sbjct: 354 NGVTS 358 >SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) Length = 449 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/66 (39%), Positives = 38/66 (57%) Frame = +3 Query: 312 LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEG 491 LN + + +F D+AKAFD V H+ LI+KL G+ + ++ IR +L+ RS V G Sbjct: 280 LNIDQGLINAVVFVDLAKAFDTVNHDILIHKLAKYGLRESSLIWIRSYLTGRSQKCFVNG 339 Query: 492 TRSRPR 509 S PR Sbjct: 340 DLSSPR 345 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 119 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 173 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 174 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 231 Query: 486 EGTRS 500 G S Sbjct: 232 NGVTS 236 >SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) Length = 775 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 508 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 562 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 563 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 620 Query: 486 EGTRS 500 G S Sbjct: 621 NGVTS 625 >SB_28146| Best HMM Match : Na_Ca_ex (HMM E-Value=0.039) Length = 751 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 337 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 391 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 392 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 449 Query: 486 EGTRS 500 G S Sbjct: 450 NGVTS 454 >SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) Length = 186 Score = 44.8 bits (101), Expect = 8e-05 Identities = 24/59 (40%), Positives = 32/59 (54%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 T L D +KAFD V H L+ KL + G+S + + DFL NR+ V+G S P I Sbjct: 25 TDLLLLDFSKAFDSVSHPRLLIKLQHYGISGQVYYWLEDFLKNRTQSVVVDGEHSSPVI 83 >SB_16993| Best HMM Match : RVT_1 (HMM E-Value=0.35) Length = 237 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 51 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 105 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 106 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 163 Query: 486 EGTRS 500 G S Sbjct: 164 NGVTS 168 >SB_7284| Best HMM Match : F5_F8_type_C (HMM E-Value=7.3e-10) Length = 725 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 539 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 593 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 594 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 651 Query: 486 EGTRS 500 G S Sbjct: 652 NGVTS 656 >SB_3080| Best HMM Match : Methylase_S (HMM E-Value=2.6) Length = 358 Score = 44.8 bits (101), Expect = 8e-05 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRPI+LL +D+ + + T + H D +D R KHSC+ LTE Sbjct: 216 YRPITLLCIVDK--VYESMMSTQVNNHF---DPKLDPCLSAYRKKHSCETTLLKLTEDWK 270 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 + ++ ++ I G L D++KAFD + ++ KL G S+ + ++R + +NR ++ Sbjct: 271 LAVDSKQFI--GILSTDMSKAFDSLHPALMVNKLKAYGFSEQSLHLMRSYFTNRQNRVKL 328 Query: 486 EGTRS 500 G S Sbjct: 329 NGVTS 333 >SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) Length = 435 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 172 RKRRNCETQLIITYHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 229 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 L+ + DFL+ RS +EG S Sbjct: 230 LLTWMEDFLTQRSQCVTLEGATS 252 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 730 RKRRNCETQLIITYHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 787 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 L+ + DFL+ RS +EG S Sbjct: 788 LLTWMEDFLTQRSQCVTLEGATS 810 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 172 RKRRNCETQLIITCHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 229 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 L+ + DFL+ RS +EG S Sbjct: 230 LLTWMEDFLTQRSQCVTLEGATS 252 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 172 RKRRNCETQLIITCHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRQLLYKLSYYGIRGS 229 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 L+ + DFL+ RS +EG S Sbjct: 230 LLTWMEDFLTQRSQCVTLEGATS 252 >SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) Length = 618 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/84 (34%), Positives = 40/84 (47%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R HSC+ LT + N L D +KAFDKV H LI KL G+ Sbjct: 336 RKNHSCETQLLLTVED-LARNTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRT 394 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRP 506 + I+ +L+NR+ V+G S+P Sbjct: 395 LAWIKSWLTNRTQRVVVDGVSSKP 418 >SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) Length = 325 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/84 (34%), Positives = 40/84 (47%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R HSC+ LT + N L D +KAFDKV H LI KL G+ Sbjct: 154 RKNHSCETQLLLTVED-LARNTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRT 212 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRP 506 + I+ +L+NR+ V+G S+P Sbjct: 213 LAWIKSWLTNRTQRVVVDGVSSKP 236 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 275 RKRRNCETQLIITCHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 332 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 L+ + DFL+ RS +EG S Sbjct: 333 LLTWMEDFLTQRSQCVTLEGATS 355 >SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) Length = 363 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/84 (34%), Positives = 40/84 (47%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R HSC+ LT + N L D +KAFDKV H LI KL G+ Sbjct: 94 RKNHSCETQLLLTVED-LARNTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRT 152 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRP 506 + I+ +L+NR+ V+G S+P Sbjct: 153 LAWIKSWLTNRTQRVVVDGVSSKP 176 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 733 RKRRNCETQLMITCHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 790 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 L+ + DFL+ RS +EG S Sbjct: 791 LLTWMEDFLTQRSQCVTLEGATS 813 >SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) Length = 900 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 507 RKRRNCETQLIITCHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 564 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 L+ + DFL+ RS +EG S Sbjct: 565 LLTWMEDFLTQRSQCVTLEGATS 587 >SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 423 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/84 (34%), Positives = 40/84 (47%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R HSC+ LT + N L D +KAFDKV H LI KL G+ Sbjct: 154 RKNHSCETQLLLTVED-LARNTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRT 212 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRP 506 + I+ +L+NR+ V+G S+P Sbjct: 213 LAWIKSWLTNRTQRVVVDGVSSKP 236 >SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13) Length = 269 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/84 (34%), Positives = 40/84 (47%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R HSC+ LT + N L D +KAFDKV H LI KL G+ Sbjct: 18 RKNHSCETQLLLTVED-LARNTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRT 76 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRP 506 + I+ +L+NR+ V+G S+P Sbjct: 77 LAWIKSWLTNRTQRVVVDGVSSKP 100 >SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) Length = 287 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/84 (34%), Positives = 40/84 (47%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R HSC+ LT + N L D +KAFDKV H LI KL G+ Sbjct: 18 RKNHSCETQLLLTVED-LARNTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRT 76 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRP 506 + I+ +L+NR+ V+G S+P Sbjct: 77 LAWIKSWLTNRTQRVVVDGVSSKP 100 >SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 197 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/52 (44%), Positives = 30/52 (57%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+ KLY+ G+ + I FL NRS V G+ S Sbjct: 33 LLLDYSKAFDKVSHSKLLKKLYHYGIEGKTLAWISGFLRNRSQYVVVNGSHS 84 >SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 393 Score = 42.3 bits (95), Expect = 4e-04 Identities = 29/84 (34%), Positives = 40/84 (47%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R HSC+ LT + N L D +KAFDKV H LI KL G+ Sbjct: 154 RKNHSCETQLLLTVED-LARNTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIRGRT 212 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRP 506 + I+ +L+NR+ V+G S+P Sbjct: 213 LAWIKSWLTNRTQRVVVDGVSSKP 236 >SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) Length = 1080 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 L D +KAFDKV H LI KL G+ + I+ +L+NR+ V+G S+P Sbjct: 582 LILDFSKAFDKVAHGRLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKP 635 >SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) Length = 242 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 L D +KAFDKV H LI KL G+ + I+ +L+NR+ V+G S+P Sbjct: 2 LILDFSKAFDKVAHGRLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKP 55 >SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/45 (44%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKL-YNMGVSD*LVLIIRDFLSNR 467 T ++ D++KAFDKV H L+YKL ++ G+S L+ +LSNR Sbjct: 559 TDVIYMDMSKAFDKVDHAALLYKLEHSFGISGSLLCWFHSYLSNR 603 >SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/57 (42%), Positives = 32/57 (56%) Frame = +3 Query: 339 GTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRPR 509 G ++FDI KAFD + H LI KL G+SD + + +LSNR V S+PR Sbjct: 16 GVVYFDIRKAFDSINHLILIDKLNWYGISDQPLTWFQSYLSNRKQQCMVNWHLSKPR 72 >SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 811 Score = 41.5 bits (93), Expect = 7e-04 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 275 RKRRNCETQLIITCHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 332 Query: 432 LVLIIRDFLSNRSFPY 479 L+ + DFL+ RS Y Sbjct: 333 LLTWMEDFLTQRSVVY 348 >SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) Length = 951 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/59 (37%), Positives = 32/59 (54%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 T L D +KAFD V H+ L+ +L + G+S + + DFL NR+ V+ S P I Sbjct: 590 TDLLLLDFSKAFDSVSHSRLLIQLQHYGISGQVYYWLEDFLKNRTQSVVVDRGHSSPAI 648 >SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) Length = 455 Score = 41.1 bits (92), Expect = 0.001 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 5/95 (5%) Frame = +3 Query: 231 IDQRAVWVRAKHS-CKEVHCLTEHI*IELNKRKLIPTGT----LFFDIAKAFDKVWHNGL 395 ++Q + +H CK +C T+ I + I G D +KAFD+V H L Sbjct: 48 LEQHGILSDFQHGFCKRRNCETQLIITCHDLVSAINQGNRVDAFILDFSKAFDRVPHRRL 107 Query: 396 IYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +YKL G+ L+ + DFL+ RS +EG S Sbjct: 108 LYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATS 142 >SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) Length = 816 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/84 (32%), Positives = 42/84 (50%) Frame = +3 Query: 249 WVRAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD 428 ++R C + LTE L+KR+ + G + D++KAFD + N L+ KL GVS Sbjct: 518 FLRGHSCCSALIKLTEDWRASLDKRESV--GVVAIDLSKAFDSICRNLLLAKLSAYGVSP 575 Query: 429 *LVLIIRDFLSNRSFPYRVEGTRS 500 + I+ +L+ R R G S Sbjct: 576 AALKTIQSYLTGRIQRVRCNGVMS 599 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/52 (44%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+YKL + G+ I FLS R+ V GT S Sbjct: 471 LLLDFSKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHS 522 >SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/49 (42%), Positives = 29/49 (59%) Frame = +3 Query: 354 DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 D +KAFD+V H L+YKL G+ L+ + DFL+ RS +EG S Sbjct: 35 DFSKAFDRVPHRRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATS 83 >SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 822 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 751 RKRRNCETQLIITYHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 808 Query: 432 LVLIIRDFLSNRS 470 L+ + DFL+ RS Sbjct: 809 LLTWMEDFLTQRS 821 >SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) Length = 447 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/53 (41%), Positives = 30/53 (56%) Frame = +3 Query: 342 TLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 TL D +KA D+V H L+YKL G+ L+ + DFL+ RS +EG S Sbjct: 82 TLLQDFSKALDRVPHRRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATS 134 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/52 (44%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+YKL + G+ I FLS R+ V GT S Sbjct: 154 LLLDFSKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHS 205 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/49 (42%), Positives = 29/49 (59%) Frame = +3 Query: 354 DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 D +KAFD+V H L+YKL G+ L+ + DFL+ RS +EG S Sbjct: 700 DFSKAFDRVPHRRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATS 748 >SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/52 (44%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+YKL + G+ I FLS R+ V GT S Sbjct: 42 LLLDFSKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHS 93 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +RS Sbjct: 831 LFFSDFSKGFDLVDHNVLIAEMSHLGVHECIIRWVSSFVSNRSQYVKIRDSRS 883 >SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) Length = 272 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +RS Sbjct: 41 LFFSDFSKGFDLVDHNVLIEEMSHLGVHECIIRWVSSFVSNRSQYVKIRDSRS 93 >SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +RS Sbjct: 681 LFFSDFSKGFDLVDHNVLIAEMSHLGVHECIIRWVSSFVSNRSQYVKIRDSRS 733 >SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) Length = 1845 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKL-YNMGVSD*LVLIIRDFLSNR 467 T ++ D++K FDKV H L+YKL ++ G+S L+ +LSNR Sbjct: 1585 TDVIYMDMSKVFDKVDHAALLYKLEHSFGISGSLLCWFHSYLSNR 1629 >SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) Length = 692 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +RS Sbjct: 362 LFFSDFSKGFDLVDHNVLIAEMSHLGVHECIIRWVSSFVSNRSQYVKIRDSRS 414 >SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/84 (33%), Positives = 39/84 (46%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R HSC+ LT + N L D +KAFDKV H LI KL G+ Sbjct: 32 RKNHSCETQLLLTVED-LARNTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRT 90 Query: 435 VLIIRDFLSNRSFPYRVEGTRSRP 506 + I+ +L+NR+ V+G +P Sbjct: 91 LAWIKSWLTNRTERVVVDGVSLKP 114 >SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) Length = 329 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 L D +KAFDKV H+ L+ KLY+ G+ + I FL NRS Sbjct: 287 LLLDYSKAFDKVSHSKLLKKLYHYGIEGKTLAWISGFLRNRS 328 >SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +RS Sbjct: 189 LFFSDFSKGFDLVDHNVLIAEMSHLGVHECIIRWVSSFVSNRSQYVKIRDSRS 241 >SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) Length = 409 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +RS Sbjct: 104 LFFSDFSKGFDLVDHNVLIAEMSHLGVHECIIRWVSSFVSNRSQYVKIRDSRS 156 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +RS Sbjct: 398 LFFSDFSKGFDLVDHNVLIAEMRHLGVHECIIRWVSSFVSNRSQYVKIRDSRS 450 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 679 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 736 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 737 LLYWFMSFLRNRTQTVVCDGKRSCPSL 763 >SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/56 (35%), Positives = 32/56 (57%) Frame = +3 Query: 324 KLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEG 491 K + T + D +KAFD V H+ L+ KL + + + L ++D LSNR+ V+G Sbjct: 744 KKLDTDLILLDFSKAFDTVSHDRLLVKLQHYKIDGQVYLWLKDLLSNRTQAVLVDG 799 >SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2362 Score = 39.9 bits (89), Expect = 0.002 Identities = 30/114 (26%), Positives = 55/114 (48%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*I 308 YRPIS+L +L + I + L LV ++ + + + + + + + Sbjct: 2151 YRPISILPTLSK--ILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 2208 Query: 309 ELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 + + KL G +F D+ KAFD V H ++ KL +G+S + R +L+NR+ Sbjct: 2209 NMEQGKLC--GAVFIDLTKAFDTVDHEIMLQKLTEIGISGNPLAWFRSYLANRT 2260 >SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 295 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 81 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 138 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 139 LLYWFMSFLRNRTQTVVCDGKRSCPSL 165 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/45 (42%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKL-YNMGVSD*LVLIIRDFLSNR 467 T ++ D++KAFDKV H L++KL ++ G+S L+ +LSNR Sbjct: 1634 TDVIYMDMSKAFDKVDHAALLHKLEHSFGISGSLLCWFHSYLSNR 1678 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 217 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 274 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 275 LLYWFMSFLRNRTQTVVCDGKRSCPSL 301 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 401 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 458 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 459 LLYWFMSFLRNRTQTVVCDGKRSCPSL 485 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 191 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 248 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 249 LLYWFMSFLRNRTQTVVCDGKRSCPSL 275 >SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) Length = 1241 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 557 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 614 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 615 LLYWFMSFLRNRTQTVVCDGKRSCPSL 641 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 393 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 450 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 451 LLYWFMSFLRNRTQTVVCDGKRSCPSL 477 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 276 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 333 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 334 LLYWFMSFLRNRTQTVVCDGKRSCPSL 360 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/87 (36%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 209 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 266 Query: 432 LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 L+ FL NR+ +G RS P + Sbjct: 267 LLYWFMSFLRNRTQTVVCDGKRSCPSL 293 >SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) Length = 242 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 172 RKRRNCETQLIITCHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 229 Query: 432 LVLIIRDFLSNRS 470 L+ + DFL+ RS Sbjct: 230 LLTWMEDFLTQRS 242 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H+ L+ K G+ L+L +R FL+NR V G S Sbjct: 229 VFLDFAKAFDSVPHDRLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASS 280 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H+ L+ K G+ L+L +R FL+NR V G S Sbjct: 673 VFLDFAKAFDSVPHDRLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASS 724 >SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) Length = 291 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RA SC+ L H LNK + L D KAFDKV H+ L KL G+S Sbjct: 27 RAGFSCETQLILAVHDWASILNKHGQVDV--LLLDFQKAFDKVSHSKLQQKLKLYGISGK 84 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 + + FL+NRS V+G +S Sbjct: 85 TLSWLSAFLTNRSQFVAVDGAKS 107 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K G+ L+L +R FL+NR V G S Sbjct: 741 VFLDFAKAFDSVPHERLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASS 792 >SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 209 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RA SC+ L H LNK + L D KAFDKV H+ L KL G+S Sbjct: 127 RAGFSCETQLILAVHDWASILNKHGQVDV--LLLDFQKAFDKVSHSKLQQKLKLYGISGK 184 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 + + FL+NRS V+G +S Sbjct: 185 TLSWLSAFLTNRSQFVAVDGAKS 207 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RA SC+ L H LNK + L D KAFDKV H+ L KL G+S Sbjct: 127 RAGFSCETQLILAVHDWASILNKHGQVDV--LLLDFQKAFDKVSHSKLQQKLKLYGISGK 184 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 + + FL+NRS V+G +S Sbjct: 185 TLSWLSAFLTNRSQFVAVDGAKS 207 >SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 630 Score = 39.1 bits (87), Expect = 0.004 Identities = 30/114 (26%), Positives = 55/114 (48%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*I 308 YRPIS+L +L + I + L LV ++ + + + + + + + Sbjct: 280 YRPISILPTLSK--ILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 337 Query: 309 ELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 + + KL G +F D+ KAFD V H ++ KL +G+S + R +L+NR+ Sbjct: 338 NMEQGKLC--GAVFIDLTKAFDTVDHEIMLQKLTEIGLSGNPLAWFRSYLANRT 389 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RA SC+ L H LNK + L D KAFDKV H+ L KL G+S Sbjct: 497 RAGFSCETQLILAVHDWASILNKHGQVDV--LLLDFQKAFDKVSHSKLQQKLKLYGISGK 554 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 + + FL+NRS V+G +S Sbjct: 555 TLSWLSAFLTNRSQFVAVDGAKS 577 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/75 (32%), Positives = 35/75 (46%) Frame = +3 Query: 282 HCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLS 461 H LT I+ K L P +F D+ KAFD V H ++ L +GV L+ + D S Sbjct: 1263 HVLTLRAIIDSAKSDLKPLNLVFVDVRKAFDSVSHETILIALKRLGVPPPLLSYVCDLYS 1322 Query: 462 NRSFPYRVEGTRSRP 506 + + G S+P Sbjct: 1323 RSTTIIQHGGRGSQP 1337 >SB_22397| Best HMM Match : DAO (HMM E-Value=7.6e-06) Length = 456 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/83 (33%), Positives = 38/83 (45%) Frame = +3 Query: 219 KDDDIDQRAVWVRAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLI 398 +DD ++ R RA HSC C + R L T D AKAFD V H L Sbjct: 262 EDDAVNNRQHTFRASHSCVTQLCHVANDWALALDRGL-QTDAFILDFAKAFDSVPHERLK 320 Query: 399 YKLYNMGVSD*LVLIIRDFLSNR 467 KL + G+S + + FL++R Sbjct: 321 VKLRSYGISGATLPWLDSFLAHR 343 >SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) Length = 427 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/45 (42%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFP 476 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNR+ P Sbjct: 171 LFFSDFSKGFDLVDHNVLIAEMSHLGVHECIIRWVSSFVSNRTMP 215 >SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) Length = 224 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RA SC+ L H LNK + L D KAFDKV H+ L KL G+S Sbjct: 77 RAGFSCETQLILAVHDWASILNKHGQVDV--LLLDFQKAFDKVSHSKLQQKLKLYGISGK 134 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 + + FL+NRS V+G +S Sbjct: 135 TLSWLSAFLTNRSQFVAVDGAKS 157 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 52 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQINSTVS 103 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K G+ L+L +R FL+NR V G S Sbjct: 47 VFLDFAKAFDSVPHERLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASS 98 >SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) Length = 275 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K G+ L+L +R FL+NR V G S Sbjct: 138 VFLDFAKAFDSVPHERLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASS 189 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RA SC+ L H LNK + L D KAFDKV H+ L KL G+S Sbjct: 833 RAGFSCETQLILAVHDWASILNKHGQVDV--LLLDFQKAFDKVSHSKLQQKLKLYGISGK 890 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 + + FL+NRS V+G +S Sbjct: 891 TLSWLSAFLTNRSQFVAVDGAKS 913 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+ KL + G+ + I FL NRS V G+ S Sbjct: 305 LLLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVIVNGSHS 356 >SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) Length = 345 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+ KL + G+ + I FL NRS V G+ S Sbjct: 143 LLLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHS 194 >SB_32049| Best HMM Match : RVT_1 (HMM E-Value=6.7e-15) Length = 716 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 T ++ D++KAFD V H L++KL G+S L+ D+L+ RS Sbjct: 445 TDVVYLDLSKAFDSVPHRKLLHKLSLFGISKPLLRWFSDYLTTRS 489 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/53 (41%), Positives = 28/53 (52%) Frame = +3 Query: 354 DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRPRI 512 D +KAFDKV H LI KL G+ L+ FL NR+ +G RS P + Sbjct: 17 DFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSCPSL 69 >SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+ KL + G+ + I FL NRS V G+ S Sbjct: 166 LLLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHS 217 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+ KL + G+ + I FL NRS V G+ S Sbjct: 1704 LLLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHS 1755 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K GV +++ +R+FL +R V G S Sbjct: 1897 IFLDFAKAFDSVPHERLLAKAQFYGVRGKMLIWLRNFLIDRRQRVVVNGACS 1948 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 345 LFF-DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTR 497 LFF D +K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +R Sbjct: 281 LFFSDFSKGFDLVDHNVLIAEMSHLGVHECIIRWVSSFVSNRSQYVKIRDSR 332 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+ KL + G+ + I FL NRS V G+ S Sbjct: 85 LLLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHS 136 >SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+ KL + G+ + I FL NRS V G+ S Sbjct: 166 LLLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHS 217 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/55 (40%), Positives = 29/55 (52%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 T L D +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 53 TDVLLLDFSKAFDSVPHQRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 107 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/55 (40%), Positives = 29/55 (52%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 T L D +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 53 TDVLLLDFSKAFDSVPHQRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 107 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 265 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 316 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/55 (40%), Positives = 29/55 (52%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 T L D +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 53 TDVLLLDFSKAFDSVPHQRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 107 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 91 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 142 >SB_21018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 716 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRPRI*RP 521 +F D+AKAFD V H L++KL + G+ L+ + +L R V G S P I RP Sbjct: 640 VFLDLAKAFDSVSHQRLLWKLSHYGILGNLLQWLNSYLIGRGQRCVVHGYNSSP-ICRP 697 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 509 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 560 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D +KAFDKV H+ L+ KL + G+ + + FL NRS V G+ S Sbjct: 732 LLLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWVSGFLRNRSQYVVVNGSHS 783 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 575 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 626 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 R + +C+ +T H + +N+ K + L D +KAFD+V H L+YKL G+ Sbjct: 1898 RKRRNCETQLIITCHDLVSAINQGKRVDAFIL--DFSKAFDRVPHRRLLYKLSYYGIRGS 1955 Query: 432 LVLIIRDFLSNRS 470 L+ + DF + RS Sbjct: 1956 LLTWMEDFFTQRS 1968 >SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1478 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 10 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 61 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/55 (40%), Positives = 29/55 (52%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 T L D +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 467 TDVLLLDFSKAFDSVPHQRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 521 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 1456 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 1507 >SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/55 (40%), Positives = 29/55 (52%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 T L D +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 264 TDVLLLDFSKAFDSVPHQQLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 318 >SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 284 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 91 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 142 >SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) Length = 531 Score = 38.3 bits (85), Expect = 0.007 Identities = 40/130 (30%), Positives = 61/130 (46%), Gaps = 5/130 (3%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSC-KEVHCLTEHI* 305 YRPISL +I E +L HL+ +D + + KH K+ C T+ I Sbjct: 387 YRPISLT------SITCKIMEHILFRHLMSH---LDSNNILLHIKHGFRKKYSCETQLIT 437 Query: 306 I--EL--NKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSF 473 + EL N + T + D +KAFD+V H L+ KL G+ + +R +L +R+ Sbjct: 438 VLHELCYNLDQGNQTDCILLDFSKAFDRVAHGRLLQKLDFYGIRGKPLTWVRSWLIHRNQ 497 Query: 474 PYRVEGTRSR 503 VEG S+ Sbjct: 498 TVVVEGETSK 507 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 772 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 823 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ KAFD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 315 VFLDLKKAFDTVNHDILLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 366 >SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 359 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/55 (38%), Positives = 29/55 (52%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 T L D +KAFD V H L+ KL G+ ++ ++ F+SNR V GT S Sbjct: 166 TDVLLLDFSKAFDSVPHQRLLIKLDFYGIRGNMLNWVKAFVSNRKQSVSVNGTVS 220 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 37.9 bits (84), Expect = 0.009 Identities = 30/79 (37%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +3 Query: 267 SCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLI 443 SC+ LT H LNK + L D +KAFDKV + LI+KL G+ + Sbjct: 892 SCETQLVLTFHDWATVLNKHGQVDA--LLLDFSKAFDKVSYPKLIHKLSRYGIKGNTLTW 949 Query: 444 IRDFLSNRSFPYRVEGTRS 500 I FL NRS V G+ S Sbjct: 950 ISAFLHNRSQFVTVNGSHS 968 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 133 IMLDFSKAFDKVSHTKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 184 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L +KAFDKV H+ L+YKL + G+ I FLS R+ V GT S Sbjct: 188 LLLHFSKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHS 239 >SB_1234| Best HMM Match : RVT_1 (HMM E-Value=3.1e-08) Length = 210 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/42 (47%), Positives = 27/42 (64%) Frame = +3 Query: 342 TLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 TL FD +KAFD + H+ L+ KL + + +V I DFLSNR Sbjct: 56 TLLFDFSKAFDFIDHSILVDKLRRLAIPRSVVNWIIDFLSNR 97 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D KAFDKV H+ L KL G+S + + FL+NRS V+G +S Sbjct: 87 LLLDFQKAFDKVSHSKLQQKLKLYGISGKTLSWLSAFLTNRSQFVAVDGAKS 138 >SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 295 Score = 37.5 bits (83), Expect = 0.011 Identities = 21/52 (40%), Positives = 27/52 (51%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K G+ L+L +R F +NR V G S Sbjct: 139 VFLDFAKAFDSVPHERLLIKAEFYGIRGRLLLWLRHFFTNRRQRVVVNGASS 190 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 37.5 bits (83), Expect = 0.011 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 3/127 (2%) Frame = +3 Query: 96 FRYNTTITILRYRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCK 275 F+ + +T+ YRPISLL + Q + + L H +Q + + R KHS Sbjct: 79 FKKGSALTLSNYRPISLL-PIFNQIFEKLICQRLN--HYLQTHNILHSNHFGFRPKHSTT 135 Query: 276 E-VHCLTEHI*--IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLII 446 V + + I IEL + G LF D++KAFD V H+ L+ KL + G+ Sbjct: 136 HAVLSVVDKIQKAIELGQ---FSCG-LFLDLSKAFDTVDHSILLRKLEHYGIRGIAYDWF 191 Query: 447 RDFLSNR 467 +L+NR Sbjct: 192 SSYLTNR 198 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 37.5 bits (83), Expect = 0.011 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 2/126 (1%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKE--VHCLTEHI 302 YRPIS++ + + ++ E L HL+ K++ + R HS + C T Sbjct: 537 YRPISIMPVISKL-MENIMFEQLYD-HLI-KNNILSDHQFGFRKLHSTTSALLDC-TNSW 592 Query: 303 *IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYR 482 + ++ RKL +F D+ KAFD V H L+ KL ++ +L+++ +L+NR + Sbjct: 593 YVNMD-RKLFNL-VVFLDLKKAFDTVNHGVLLRKLEMYSITGNALLLLQSYLTNRKQKCQ 650 Query: 483 VEGTRS 500 + G S Sbjct: 651 LNGVMS 656 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K GV +++ +R+FL +R V G S Sbjct: 1627 IFLDFAKAFDSVPHERLLAKAQFYGVRGKMLIWLRNFLIDRRQRVVVNGACS 1678 >SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D KAFDKV H+ L KL G+S + + FL+NRS V+G +S Sbjct: 692 LLLDFQKAFDKVSHSKLQQKLKLYGISGKTLSWLSAFLTNRSQFVAVDGAKS 743 >SB_40030| Best HMM Match : RVT_1 (HMM E-Value=0.0013) Length = 268 Score = 37.5 bits (83), Expect = 0.011 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 1/94 (1%) Frame = +3 Query: 222 DDDIDQRAVWVRAKHSCKEVHC-LTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLI 398 D +D R KHSC+ LTE + ++ ++ I G L D++KAFD + ++ Sbjct: 94 DHKLDPCLSAYRKKHSCETTLLKLTEDWKLAVDSKQFI--GILSTDMSKAFDSLHPALMV 151 Query: 399 YKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 KL G S+ + ++R + +NR ++ G S Sbjct: 152 NKLKAYGFSEQSLHLMRSYFTNRQNRVKLNGVTS 185 >SB_33916| Best HMM Match : Hormone_2 (HMM E-Value=8.8) Length = 170 Score = 37.5 bits (83), Expect = 0.011 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 1/94 (1%) Frame = +3 Query: 222 DDDIDQRAVWVRAKHSCKEVHC-LTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLI 398 D +D R KHSC+ LTE + ++ ++ I G L D++KAFD + ++ Sbjct: 10 DPKLDPCLSAYRKKHSCETTLLKLTEDWKLAVDSKQFI--GILSTDMSKAFDSLHPALMV 67 Query: 399 YKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 KL G S+ + ++R + +NR ++ G S Sbjct: 68 NKLKAYGFSEQSLHLMRSYFTNRQNRVKLNGVTS 101 >SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1677 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L D KAFDKV H+ L KL G+S + + FL+NRS V+G +S Sbjct: 1282 LLLDFQKAFDKVSHSKLQQKLKLYGISGKTLSWLSAFLTNRSQFVAVDGAKS 1333 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 ++ D AKAFD V H LI+KL++ G ++ +LS+R+ V+G S P Sbjct: 650 IYLDFAKAFDSVSHARLIHKLHHYGFRGKVLDWFTHYLSDRTQCTVVQGATSSP 703 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 37.1 bits (82), Expect = 0.015 Identities = 36/125 (28%), Positives = 56/125 (44%) Frame = +3 Query: 132 RPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*IE 311 RPISL L + T S +L G+ VQ +D + V K SC+ H+ +E Sbjct: 401 RPISLTCHLAKAMEGFTLSRSLPGI--VQH---LDTKQFAVAGK-SCQHAIVYLLHLTLE 454 Query: 312 LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEG 491 +R + F D K FD + H+ L+ KL ++ + L+ I FL R+ + Sbjct: 455 ALERGGVWVRWFFADFKKGFDLIDHHILLNKLCSLDIHPCLLRWIASFLEGRTQVVSIAS 514 Query: 492 TRSRP 506 + S P Sbjct: 515 STSPP 519 >SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 192 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 243 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 56 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 107 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 533 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 584 >SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) Length = 252 Score = 37.1 bits (82), Expect = 0.015 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 3/127 (2%) Frame = +3 Query: 96 FRYNTTITILRYRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCK 275 F+ + +T+ YRPISLL + Q + + L H +Q + + R KHS Sbjct: 25 FKKGSALTLSNYRPISLL-PIFNQIFEKLICQRLN--HYLQTHNILYSNQFGFRPKHSTT 81 Query: 276 E-VHCLTEHI*--IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLII 446 V + + I IEL + G LF D++KAFD V H+ L+ KL + G+ Sbjct: 82 HAVLSVVDKIQKAIELGQ---FSCG-LFLDLSKAFDTVDHSILLRKLEHYGIRGIAYDWF 137 Query: 447 RDFLSNR 467 +L+NR Sbjct: 138 SSYLTNR 144 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 ++ D AKAFD V H LI+KL++ G ++ +LS+R+ V+G S P Sbjct: 241 IYLDFAKAFDSVSHARLIHKLHHYGFRGKVLDWFTHYLSDRTQCTVVQGATSSP 294 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 37.1 bits (82), Expect = 0.015 Identities = 36/125 (28%), Positives = 56/125 (44%) Frame = +3 Query: 132 RPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*IE 311 RPISL L + T S +L G+ VQ +D++ V K SC+ H+ +E Sbjct: 137 RPISLTCHLAKAMEGFTLSRSLPGI--VQH---LDRKQFAVAGK-SCQHAIVYLLHLTLE 190 Query: 312 LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEG 491 R + F D K FD + H+ L+ KL ++ + L+ I FL R+ + Sbjct: 191 ALDRGGVWVRWFFADFKKGFDLIDHHILLNKLCSLDIHPCLLRWIASFLEGRTQVVSIAS 250 Query: 492 TRSRP 506 + S P Sbjct: 251 STSPP 255 >SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + FD KAFD + HN L+ KL + D ++ I DFLS R Sbjct: 89 VLFDFRKAFDLIDHNILLTKLRTFNIPDAIIAWITDFLSYR 129 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 1259 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 1310 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 T ++ D +KA D V H L++KL G+S L+ D+L+ RS V+G S Sbjct: 59 TDVVYLDFSKALDSVPHRKLLHKLSLFGISGPLLHWFSDYLTTRSQRVLVDGAFS 113 >SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 37.1 bits (82), Expect = 0.015 Identities = 29/114 (25%), Positives = 55/114 (48%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*I 308 YRPIS+L +L + I + L LV ++ + + + + + + + Sbjct: 114 YRPISILPTLSK--ILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 171 Query: 309 ELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 + + KL G +F D+ KAFD V H ++ KL +G+S + R +L++R+ Sbjct: 172 NMEQGKLC--GAVFIDLTKAFDTVDHEIMLQKLTEIGLSGNPLAWFRSYLASRT 223 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 1923 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 1974 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 243 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 294 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 56 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 107 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 ++ D AKAFD V H LI+KL++ G ++ +LS+R+ V+G S P Sbjct: 184 IYLDFAKAFDSVSHARLIHKLHHYGFRGKVLDWFAHYLSDRTQCTVVQGATSSP 237 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 37.1 bits (82), Expect = 0.015 Identities = 29/114 (25%), Positives = 55/114 (48%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*I 308 YRPIS+L +L + I + L LV ++ + + + + + + + Sbjct: 412 YRPISILPTLSK--ILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 469 Query: 309 ELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 + + KL G +F D+ KAFD V H ++ KL +G+S + R +L++R+ Sbjct: 470 NMEQGKLC--GAVFIDLTKAFDTVDHEIMLQKLTEIGLSGNPLAWFRSYLASRT 521 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 211 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 262 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV H L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 272 IMLDFSKAFDKVSHAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 323 >SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) Length = 365 Score = 37.1 bits (82), Expect = 0.015 Identities = 29/114 (25%), Positives = 55/114 (48%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*I 308 YRPIS+L +L + I + L LV ++ + + + + + + + Sbjct: 162 YRPISILPTLSK--ILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 219 Query: 309 ELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 + + KL G +F D+ KAFD V H ++ KL +G+S + R +L++R+ Sbjct: 220 NMEQGKLC--GAVFIDLTKAFDTVDHEIMLQKLTEIGLSGNPLAWFRSYLASRT 271 >SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 37.1 bits (82), Expect = 0.015 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 3/127 (2%) Frame = +3 Query: 96 FRYNTTITILRYRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCK 275 F+ + +T+ YRPISLL + Q + + L H +Q + + R KHS Sbjct: 25 FKKGSALTLSNYRPISLL-PIFNQIFEKLICQRLN--HYLQTHNILYSNQFGFRPKHSTT 81 Query: 276 E-VHCLTEHI*--IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLII 446 V + + I IEL + G LF D++KAFD V H+ L+ KL + G+ Sbjct: 82 HAVLSVVDKIQKAIELGQ---FSCG-LFLDLSKAFDTVDHSILLRKLEHYGIRGIAYDWF 137 Query: 447 RDFLSNR 467 +L+NR Sbjct: 138 SSYLTNR 144 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 36.7 bits (81), Expect = 0.020 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 5/130 (3%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSC-KEVHCLTEHI* 305 YRPISL +I E +L HL+ +D + + +H K+ C T+ I Sbjct: 104 YRPISLT------SITCKIMEHILFRHLMSH---LDSNNILLHIQHGFRKKYSCETQLIT 154 Query: 306 I--EL--NKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSF 473 + EL N + T + D +KAFD+V H L+ KL G+ + +R +L +R+ Sbjct: 155 VLHELCYNLDQGNQTDCILLDFSKAFDRVAHGRLLQKLDFYGIRGKPLTWVRSWLIHRNQ 214 Query: 474 PYRVEGTRSR 503 VEG S+ Sbjct: 215 TVVVEGETSK 224 >SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = +3 Query: 342 TLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 TL FD KAFD + H+ L+ KL + + +V I DFLSNR Sbjct: 394 TLLFDYRKAFDFIDHSILVDKLSRLAIPRSVVNWIIDFLSNR 435 >SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/44 (43%), Positives = 28/44 (63%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 +G ++FDI KAFD + H LI KL G+SD + + +LS+R Sbjct: 15 SGVVYFDIRKAFDSINHLILIDKLNWYGISDQPLTWFQSYLSDR 58 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 36.7 bits (81), Expect = 0.020 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + FD KAFD + HN L+ KL + D ++ I DFLS R Sbjct: 475 VLFDFRKAFDLIDHNILLTKLRTFNIPDAIIAWITDFLSCR 515 >SB_12448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 +F D+AKAFD V H L++KL G+S L+ + +L R Sbjct: 277 VFLDLAKAFDSVSHQRLLWKLSRYGISGNLLQWLNSYLIGR 317 >SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) Length = 208 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +3 Query: 339 GTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 G +F D+ KAFD V H ++ KL +G+S + R +L+NR+ Sbjct: 8 GAVFIDLTKAFDTVDHEIMLQKLTEIGLSGNPLAWFRSYLANRT 51 >SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 36.7 bits (81), Expect = 0.020 Identities = 25/71 (35%), Positives = 37/71 (52%) Frame = +3 Query: 288 LTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 LTE L+KR+ + G + D++KAF + HN L+ KL GVS + I+ +L+ R Sbjct: 114 LTEDWRASLDKRESV--GVVAIDLSKAFYSICHNLLLAKLSAYGVSPAALKTIQSYLTGR 171 Query: 468 SFPYRVEGTRS 500 R G S Sbjct: 172 FQRVRCNGAVS 182 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 36.7 bits (81), Expect = 0.020 Identities = 30/83 (36%), Positives = 39/83 (46%), Gaps = 1/83 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RA SC+ L H LNK + L D KAFDKV H+ L KL G+S Sbjct: 749 RAGFSCETQLILAVHDWASILNKHGQVDV--LLLDFQKAFDKVSHSKLQQKLKLYGISGK 806 Query: 432 LVLIIRDFLSNRSFPYRVEGTRS 500 + + L+NRS V+G +S Sbjct: 807 TLSWLSALLTNRSQFVAVDGAKS 829 >SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/53 (39%), Positives = 30/53 (56%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 +FD AKAFD V H LI+KL++ GV ++ L NR+ ++G S P Sbjct: 121 YFDFAKAFDSVSHARLIHKLHHYGVRGQSPRLVHALL-NRTQCTVIQGATSSP 172 >SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) Length = 642 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = +3 Query: 342 TLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 TL FD KAFD + H+ L+ KL + + +V I DFLSNR Sbjct: 312 TLLFDYRKAFDFIDHSILVDKLSRLAIPRSVVNWIIDFLSNR 353 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ K FD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 265 VFLDLKKEFDTVNHDILLQKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 316 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D+ K FD V H+ L+ KL G++ +L+I+ +LSNR ++ T S Sbjct: 554 VFLDLKKEFDTVNHDILLQKLELNGITGNALLLIQSYLSNRKQKCQLNSTVS 605 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/47 (44%), Positives = 27/47 (57%) Frame = +3 Query: 360 AKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +KAFDKV H+ L+YKL + G+ I FLS R+ V GT S Sbjct: 3 SKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHS 49 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 36.7 bits (81), Expect = 0.020 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 5/130 (3%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSC-KEVHCLTEHI* 305 YRPISL +I E +L HL+ +D + + +H K+ C T+ I Sbjct: 958 YRPISLT------SITCKIMEHILFRHLMSH---LDSNNILLHIQHGFRKKYSCETQLIT 1008 Query: 306 I--EL--NKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSF 473 + EL N + T + D +KAFD+V H L+ KL G+ + +R +L +R+ Sbjct: 1009 VLHELCYNLDQGNQTDCILLDFSKAFDRVAHGRLLQKLDFYGIRGKPLTWVRSWLIHRNQ 1068 Query: 474 PYRVEGTRSR 503 VEG S+ Sbjct: 1069 TVVVEGETSK 1078 >SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 171 Score = 36.7 bits (81), Expect = 0.020 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +3 Query: 339 GTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 G +F D+ KAFD V H ++ KL +G+S + R +L+NR+ Sbjct: 8 GAVFIDLTKAFDTVDHEIMLQKLTEIGLSGNPLAWFRSYLANRT 51 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 L D +KAFDKV H+ L+ KL + G+ + I FL NRS Sbjct: 1142 LLLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRS 1183 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 36.3 bits (80), Expect = 0.027 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 3/81 (3%) Frame = +3 Query: 267 SCKEV-HCLTEHI*IELNKRKLIPTGTLFF--DIAKAFDKVWHNGLIYKLYNMGVSD*LV 437 +CK + H + H+ L +I F D KAFDKV H+ L KL G+S + Sbjct: 945 ACKVMEHVVLSHLNKHLAAHNIISNLQHGFRADFQKAFDKVSHSKLQQKLKLYGISGKTL 1004 Query: 438 LIIRDFLSNRSFPYRVEGTRS 500 + FL+NRS V+G +S Sbjct: 1005 SWLSAFLTNRSQFVAVDGAKS 1025 >SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1015 Score = 36.3 bits (80), Expect = 0.027 Identities = 37/127 (29%), Positives = 56/127 (44%) Frame = +3 Query: 132 RPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*IE 311 RPISL L + T S +L G+ VQ +D + V K SC+ H+ +E Sbjct: 512 RPISLTCHLAKAMEGFTLSRSLPGI--VQH---LDTKQFAVAGK-SCQHAIVYLLHLTLE 565 Query: 312 LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEG 491 R + F D K FD + H+ L+ KL ++ + L+ I FL R+ + Sbjct: 566 ALDRGGVWVRWFFADFKKGFDLIDHHILLNKLCSLYIHPCLLRWIASFLEGRTQVVSIAS 625 Query: 492 TRSRPRI 512 + S P I Sbjct: 626 STSPPLI 632 >SB_3609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 36.3 bits (80), Expect = 0.027 Identities = 21/58 (36%), Positives = 32/58 (55%) Frame = +3 Query: 249 WVRAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGV 422 ++R C + LTE L+KR+ + G + D++KAFD + HN L+ KL GV Sbjct: 46 FLRGHSCCSALIKLTEDWRASLDKRESV--GVVAIDLSKAFDSICHNLLLAKLSAYGV 101 >SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) Length = 401 Score = 36.3 bits (80), Expect = 0.027 Identities = 39/127 (30%), Positives = 59/127 (46%), Gaps = 3/127 (2%) Frame = +3 Query: 96 FRYNTTITILRYRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCK 275 F+ + T+ YRPISLL + Q + + L H +Q + + R KHS Sbjct: 236 FKKGSAFTLSNYRPISLL-PIFNQIFEKLICQRLN--HYLQTHNILYSNQFGFRPKHSTT 292 Query: 276 E-VHCLTEHI*--IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLII 446 V + + I IEL + G LF D++KAFD V H+ L+ KL + G+ Sbjct: 293 HAVLSVVDKIQKAIELGQ---FSCG-LFLDLSKAFDTVDHSILLRKLEHYGIRGIAYDWF 348 Query: 447 RDFLSNR 467 +L+NR Sbjct: 349 SSYLTNR 355 >SB_20736| Best HMM Match : DUF1628 (HMM E-Value=9.4) Length = 169 Score = 35.9 bits (79), Expect = 0.035 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +3 Query: 282 HCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGV 422 H LT I+ K L P +F D++KAFD V H ++ L +GV Sbjct: 117 HVLTLRAIIDSAKSDLKPLNLVFVDVSKAFDSVSHETILIALKRLGV 163 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 35.9 bits (79), Expect = 0.035 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD 428 L D +KAFDKV H+ L+YKL + G+ D Sbjct: 42 LLLDFSKAFDKVSHSKLLYKLRSYGICD 69 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 35.9 bits (79), Expect = 0.035 Identities = 26/83 (31%), Positives = 41/83 (49%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R K+SC E +T + N + T + D +KAFD+V H L+ KL G+ Sbjct: 117 RKKYSC-ETQLITVLHELCYNLDQGNQTDCILLDFSKAFDRVAHGRLLQKLDFYGIRGKP 175 Query: 435 VLIIRDFLSNRSFPYRVEGTRSR 503 + +R +L +R+ VEG S+ Sbjct: 176 LTWVRSWLIHRNQTVVVEGETSK 198 >SB_58475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +3 Query: 354 DIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVE 488 D +KAFD V + L+ KLY +G S + + +LS+RS+ +++ Sbjct: 3 DFSKAFDTVHYTTLVRKLYTLGFSKSFLTWLCSYLSDRSYYVQID 47 >SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +3 Query: 363 KAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 K FD V HN LI ++ ++GV + ++ + F+SNRS ++ +RS Sbjct: 669 KGFDLVDHNVLIAEMSHLGVHECIIRWVSSFVSNRSQYVKIRDSRS 714 >SB_50245| Best HMM Match : RVT_1 (HMM E-Value=1.4e-16) Length = 311 Score = 35.5 bits (78), Expect = 0.046 Identities = 23/77 (29%), Positives = 33/77 (42%) Frame = +3 Query: 270 CKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIR 449 C+ + L H I + L P +F D+ KAFD V H L+ +GV L+ I Sbjct: 41 CQNIWLL--HTLIRRSTDLLRPLKLVFLDVKKAFDSVSHESLLIAAKRLGVPGPLLTYIN 98 Query: 450 DFLSNRSFPYRVEGTRS 500 + S + V G S Sbjct: 99 ELYSRSETVFEVGGESS 115 >SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 35.5 bits (78), Expect = 0.046 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 1/114 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI*- 305 YRPIS++ S + + ++ + L +K + + R HS + H + E + Sbjct: 202 YRPISIICSFSKILEKLIYNQLIFFL---EKHKILFEFQFGFRKGHSTE--HAILETVET 256 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 ++ + + + T +F D +KAFD + H+ L+ K+Y GV +LSNR Sbjct: 257 LKSSIDQGMTTCAIFLDFSKAFDTINHDILLAKMYKYGVRGTPAKWFSSYLSNR 310 >SB_56177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 35.5 bits (78), Expect = 0.046 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 ++ D++KAFDKV H L+ KL + G L+ +L+ R G S+P Sbjct: 2 VYMDMSKAFDKVCHTRLLQKLRDFGFGGNLLQWFASYLTGRQQRVTSPGALSKP 55 >SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 35.5 bits (78), Expect = 0.046 Identities = 25/71 (35%), Positives = 30/71 (42%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R KHSC C + R L T D AKAFD + H L KLY+ G+ Sbjct: 117 RKKHSCVTQLCFVINDWASTLDRGL-QTDAFVLDFAKAFDSIPHERLKSKLYSYGIGGQT 175 Query: 435 VLIIRDFLSNR 467 + I FL R Sbjct: 176 LKWIDAFLCER 186 >SB_34598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = +3 Query: 330 IPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + T D AKAFD V H L +KL + G+S + + FL++R V G +S Sbjct: 129 LQTDAFILDFAKAFDSVPHERLKFKLRSYGISGATLRWLDSFLAHRYQRVVVNGAKS 185 >SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) Length = 510 Score = 35.5 bits (78), Expect = 0.046 Identities = 40/126 (31%), Positives = 51/126 (40%), Gaps = 2/126 (1%) Frame = +3 Query: 129 YRPISLLLSLDR--QNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHCLTEHI 302 YRPISL + + ++I + L H + D Q A R K SC C + Sbjct: 116 YRPISLTSVICKILEHIVCSHINRHLEAHQILSDR---QHAF--RKKRSCVTQLCFVIND 170 Query: 303 *IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYR 482 R L T D AKAFD V H L KLY+ G+ + I FL R Sbjct: 171 WASALDRGL-QTDAFVLDFAKAFDSVPHERLKSKLYSYGIGGQTLKWIDAFLYERYQRVC 229 Query: 483 VEGTRS 500 V G +S Sbjct: 230 VNGAKS 235 >SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) Length = 416 Score = 35.5 bits (78), Expect = 0.046 Identities = 28/82 (34%), Positives = 34/82 (41%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*L 434 R K SC C + R L T D+AKAFD V H L YKLY+ G+ Sbjct: 287 RKKRSCVTQLCFVINDWASALDRGL-QTDASVLDLAKAFDSVPHERLKYKLYSYGIGGQT 345 Query: 435 VLIIRDFLSNRSFPYRVEGTRS 500 + FL R V G +S Sbjct: 346 LKWNDAFLRERYQRVCVHGAKS 367 >SB_55916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K GV +++ +R+FL +R V G S Sbjct: 56 IFLDFAKAFDSVPHERLLAKAQFYGVRGKMLIWLRNFLIDRRQRVVVNGACS 107 >SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) Length = 362 Score = 35.1 bits (77), Expect = 0.061 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKL-YNMGVS 425 T ++ D++KAFDKV H L+YKL ++ G+S Sbjct: 130 TNVIYMDMSKAFDKVDHAALLYKLEHSFGIS 160 >SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 243 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K GV +++ +R+FL +R V G S Sbjct: 33 IFLDFAKAFDSVPHERLLAKAQFYGVRGKMLIWLRNFLIDRRQRVVVNGACS 84 >SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) Length = 327 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K GV +++ +R+FL +R V G S Sbjct: 56 IFLDFAKAFDSVPHERLLAKAQFYGVRGKMLIWLRNFLIDRRQRVVVNGACS 107 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 35.1 bits (77), Expect = 0.061 Identities = 19/51 (37%), Positives = 30/51 (58%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTR 497 + D++KAFDKV H+ LI+KL GV+ L+ +L+ R ++G R Sbjct: 680 IHLDLSKAFDKVPHHLLIFKLQQYGVTGYLLKWFVSYLTARRQRVVLDGVR 730 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 35.1 bits (77), Expect = 0.061 Identities = 28/73 (38%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = +3 Query: 255 RAKHSCKEVHCLTEHI*IE-LNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD* 431 RAK S LT H + + + K I L D +KAFDKV H LI KL G+ Sbjct: 518 RAKRSTVTQLILTIHDMAKAIQENKSIHAAVL--DFSKAFDKVPHERLIKKLQYYGIHGP 575 Query: 432 LVLIIRDFLSNRS 470 L+ FL NR+ Sbjct: 576 LLYWFMSFLRNRT 588 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 35.1 bits (77), Expect = 0.061 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +F D AKAFD V H L+ K GV +++ +R+FL +R V G S Sbjct: 465 IFLDFAKAFDSVPHERLLAKAQFYGVRGKMLIWLRNFLIDRRQRVVVNGACS 516 >SB_21896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 759 Score = 34.7 bits (76), Expect = 0.081 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + FD KAFD + HN L+ K++ + + + L + DFL++R Sbjct: 580 VLFDYRKAFDLIDHNLLVRKIFELDIPRAVALWVVDFLTDR 620 >SB_21856| Best HMM Match : RVT_1 (HMM E-Value=4.5e-32) Length = 583 Score = 34.7 bits (76), Expect = 0.081 Identities = 19/58 (32%), Positives = 26/58 (44%) Frame = +3 Query: 327 LIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 L P +F D+ KAFD V H L+ +GV L+ I + S + V G S Sbjct: 101 LRPLKLVFLDVKKAFDSVSHESLLIAAKRLGVPGPLLTYINELYSRSETVFEVGGESS 158 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 34.7 bits (76), Expect = 0.081 Identities = 38/130 (29%), Positives = 61/130 (46%), Gaps = 5/130 (3%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSC-KEVHCLTEHI* 305 YRPISL +I E +L HL+ +D + + +H K+ C T+ I Sbjct: 589 YRPISLT------SITCKIMEHILFRHLMSH---LDSNNILLHIQHGFRKKYSCETQLIT 639 Query: 306 I--EL--NKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSF 473 + EL + + T + D +KAFD+V H L+ KL G+ + +R +L +R+ Sbjct: 640 VLHELCYSLDQGNQTDCILLDFSKAFDRVAHGRLLQKLDFYGIRGKPLTWVRSWLIHRNQ 699 Query: 474 PYRVEGTRSR 503 VEG S+ Sbjct: 700 TVVVEGETSK 709 >SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) Length = 727 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSR 503 T + D +KAFD+V H L+ KL G+ + +R +L +R+ VEG S+ Sbjct: 26 TDCILLDFSKAFDRVAHGRLLQKLDFYGIRGKPLTWVRSWLIHRNQTVVVEGETSK 81 >SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 411 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D +KAFDKV + L +KL++ G+ + I FL+NR+ V+G+ S Sbjct: 141 IMLDFSKAFDKVSNAKLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHS 192 >SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSR 503 ++ D++KAFDKV H L+ KL + G L+ +L+ R V G S+ Sbjct: 237 VYMDMSKAFDKVCHTRLLQKLRDFGFGGNLLQWFASYLTGRQQRVTVPGDISK 289 >SB_44863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/76 (32%), Positives = 37/76 (48%) Frame = +3 Query: 279 VHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFL 458 +HC+ E + KR F D +K FD V HN L+ +L +GV++ L I FL Sbjct: 59 LHCILESL-----KRGKNYVRIFFADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFL 113 Query: 459 SNRSFPYRVEGTRSRP 506 + R ++ G S P Sbjct: 114 TARPQRVKISGHTSSP 129 >SB_38467| Best HMM Match : RVT_1 (HMM E-Value=4.2e-05) Length = 400 Score = 34.3 bits (75), Expect = 0.11 Identities = 38/127 (29%), Positives = 57/127 (44%), Gaps = 3/127 (2%) Frame = +3 Query: 96 FRYNTTITILRYRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCK 275 F+ + +T+ YRPISLL + Q + + L H +Q + + R KHS Sbjct: 164 FKKGSALTLFNYRPISLL-PIFNQIFEKLICQRLN--HYLQTHNILYSNQFGFRPKHSTT 220 Query: 276 E-VHCLTEHI*--IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLII 446 V + + I IEL + LF D +KAFD V H+ L+ KL + G Sbjct: 221 HAVLSVVDKIQKAIELGQYSC----GLFLDPSKAFDTVDHSILLRKLEHYGFRGIAYDWF 276 Query: 447 RDFLSNR 467 +L+NR Sbjct: 277 SSYLTNR 283 >SB_44245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 404 Score = 33.9 bits (74), Expect = 0.14 Identities = 25/76 (32%), Positives = 37/76 (48%) Frame = +3 Query: 279 VHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFL 458 +HC+ E + KR F D +K FD V HN L+ +L +GV++ L I FL Sbjct: 211 LHCILESL-----KRGENYVRIFFADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFL 265 Query: 459 SNRSFPYRVEGTRSRP 506 + R ++ G S P Sbjct: 266 TARPQRVKISGHTSSP 281 >SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) Length = 329 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = +3 Query: 297 HI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFP 476 H +EL +R F D +K FD V HN L+ +L +GV++ L I FL+ R Sbjct: 93 HCILELLERGENYVRIFFADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFLTARLQR 152 Query: 477 YRVEGTRSRP 506 ++ G S P Sbjct: 153 VKISGHTSSP 162 >SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) Length = 270 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/57 (36%), Positives = 26/57 (45%) Frame = +3 Query: 330 IPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + T D AKAFD V H L KLY+ G+ + I FL R V G +S Sbjct: 29 LQTDAFVLDFAKAFDSVPHERLKSKLYSYGIGGQTLKWIDAFLCERFQRVCVNGAKS 85 >SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) Length = 339 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGV 422 L D +KAFDKV H+ L+YKL + G+ Sbjct: 312 LLLDFSKAFDKVSHSKLLYKLRSYGI 337 >SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) Length = 382 Score = 33.9 bits (74), Expect = 0.14 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 3/127 (2%) Frame = +3 Query: 96 FRYNTTITILRYRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCK 275 F+ + +T+ YR ISLL + Q + + L H +Q + + R KHS Sbjct: 159 FKKGSALTLSNYRSISLL-PIFNQIFEKLICQRLN--HYLQTHNILYSNQFGFRPKHSTT 215 Query: 276 E-VHCLTEHI*--IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLII 446 V + + I IEL + G LF D++KAFD V H+ L+ KL + G+ Sbjct: 216 HAVLSVVDKIQKAIELGQ---FSCG-LFLDLSKAFDTVDHSILLRKLEHYGIRGIAFDWF 271 Query: 447 RDFLSNR 467 +L+NR Sbjct: 272 SSYLTNR 278 >SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) Length = 710 Score = 33.9 bits (74), Expect = 0.14 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = +3 Query: 297 HI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFP 476 H +EL +R F D +K FD V HN L+ +L +GV++ L I FL+ R Sbjct: 420 HCILELLERGENYVRIFFADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFLTARLQR 479 Query: 477 YRVEGTRSRP 506 ++ G S P Sbjct: 480 VKISGHTSSP 489 >SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGV 422 L D +KAFDKV H+ L+YKL + G+ Sbjct: 154 LLLDFSKAFDKVSHSKLLYKLRSYGI 179 >SB_34652| Best HMM Match : Ank (HMM E-Value=3.8e-34) Length = 1330 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/57 (36%), Positives = 26/57 (45%) Frame = +3 Query: 330 IPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + T D AKAFD V H L KLY+ G+ + I FL R V G +S Sbjct: 877 LQTDAFVLDFAKAFDSVPHERLKSKLYSYGIGGQTLKWIDAFLCERYQRVFVNGAKS 933 >SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) Length = 731 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +3 Query: 309 ELNKRKLIPTGTLF-FDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 +LN K + +F FD +KAFD V H + KL + ++ ++ +I FL NR V Sbjct: 326 QLNINKDVDFVRVFSFDFSKAFDSVSHEIVCRKLKSYDINPYVINLIVSFLGNRKQRVVV 385 Query: 486 EGTRSR 503 +G ++ Sbjct: 386 DGVSTK 391 >SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23) Length = 457 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 +G L D+ KAFD V HN L+ KL G + + + +LS R+ Sbjct: 247 SGMLLIDLKKAFDLVDHNTLLLKLVLYGCDELTLKWFKSYLSGRT 291 >SB_19953| Best HMM Match : Trehalase (HMM E-Value=0.66) Length = 1097 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +3 Query: 342 TLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 T+ FD KAFD++ H+ L+ KL + + I DFL++R Sbjct: 535 TILFDFRKAFDRIDHHILVRKLMTYDLPSTITAWIVDFLTSR 576 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 342 TLFFDIAKAFDKVWHNGLIYKL 407 T+ FD KAFD++ H+ L+ KL Sbjct: 839 TILFDFRKAFDRIDHHILVRKL 860 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGV 422 L D +KAFDKV H+ L+YKL + G+ Sbjct: 236 LLLDFSKAFDKVSHSKLLYKLRSYGI 261 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/54 (37%), Positives = 28/54 (51%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 L D +KAFDKV H L+ KL ++GV I +L+ R ++G S P Sbjct: 309 LILDFSKAFDKVPHTRLLAKLDHLGVEGNTHGWIATWLTKRYQQVTLDGASSAP 362 >SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 895 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 +F D++KAFD V H L+ KL+N G+ + +LS+R Sbjct: 841 VFIDLSKAFDTVNHGILLAKLHNYGIRGTPLKWFESYLSDR 881 >SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/57 (36%), Positives = 26/57 (45%) Frame = +3 Query: 330 IPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + T D AKAFD V H L KLY+ G+ + I FL R V G +S Sbjct: 545 LQTDAFVLDFAKAFDSVPHERLKSKLYSYGIGGQTLKWIDAFLCERYQLVCVNGAKS 601 >SB_51319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + FD KAFD + HN L+ K++ + + + + DFL +R Sbjct: 36 VLFDYKKAFDLIDHNRLVRKIFGLDIPRGVACWVADFLMHR 76 >SB_36141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 336 TGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRS 470 +G L D+ KAFD V HN L+ KL G + + + +LS R+ Sbjct: 8 SGMLLIDLKKAFDLVDHNTLLLKLALYGCDELTLKWFKSYLSGRT 52 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/54 (37%), Positives = 28/54 (51%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 L D +KAFDKV H L+ KL ++GV I +L+ R ++G S P Sbjct: 377 LILDFSKAFDKVPHTRLLAKLDHLGVEGNTHGWIATWLTKRYQQVTLDGASSTP 430 >SB_7055| Best HMM Match : RVT_1 (HMM E-Value=0.00051) Length = 198 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + D++KAFDKV H+ LI KL GV+ L+ +L+ R ++G S Sbjct: 35 IHLDLSKAFDKVSHHLLISKLQQYGVTGSLLKWFVSYLTGRRQRVVLDGASS 86 >SB_59586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 F D +K FD V HN L+ +L +GV++ L I FL+ R ++ G S P Sbjct: 289 FADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFLTARPQRVKISGHTSSP 341 >SB_43683| Best HMM Match : RVT_1 (HMM E-Value=0.024) Length = 474 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 F D++KAFD V H L+ KL+N G+ + +LS+R Sbjct: 161 FIDLSKAFDTVNHGILLAKLHNYGIRGNPLKWFESYLSDR 200 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 33.1 bits (72), Expect = 0.25 Identities = 27/101 (26%), Positives = 49/101 (48%), Gaps = 1/101 (0%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCK-EVHCLTEHI* 305 YRPIS+L + + ++ + L +Q + R +HS + C + + Sbjct: 1380 YRPISILPDVSKV-LERVVHQQLTAY--LQSNSIFSPYQCGFRKRHSTEWAAICFADSVR 1436 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD 428 ++ + TG +F D++KAFD V H L+ KL +GV++ Sbjct: 1437 RNIDLGMM--TGAMFIDLSKAFDTVCH-VLLQKLPGLGVAE 1474 >SB_57531| Best HMM Match : RVT_1 (HMM E-Value=2.9e-10) Length = 230 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 F D +K FD V HN L+ +L +GV++ L I FL+ R ++ G S P Sbjct: 55 FADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFLTARPQRVKISGHTSSP 107 >SB_51811| Best HMM Match : Vicilin_N (HMM E-Value=1.9) Length = 406 Score = 33.1 bits (72), Expect = 0.25 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 262 VLLDLKKAFDTVDHEILLRKMQILGISHDALYLIKSYLSGR 302 >SB_45694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 F D +K FD V HN L+ +L +GV++ L I FL+ R ++ G S P Sbjct: 41 FADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFLTARPQRVKISGHTSSP 93 >SB_38694| Best HMM Match : RVT_1 (HMM E-Value=3.8e-09) Length = 457 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 F D +K FD V HN L+ +L +GV++ L I FL+ R ++ G S P Sbjct: 240 FADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFLTARPQRVKISGHTSSP 292 >SB_18340| Best HMM Match : Vicilin_N (HMM E-Value=1.5) Length = 406 Score = 33.1 bits (72), Expect = 0.25 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 262 VLLDLKKAFDTVDHEILLRKMQILGISHDALYLIKSYLSGR 302 >SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) Length = 602 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = +3 Query: 330 IPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 + T + D AKAFD V H + KL G+S + + FLS+R V G +S Sbjct: 479 LQTDAVILDFAKAFDCVPHERIKVKLRGCGISGATLQWLDSFLSHRYQRVVVNGAKS 535 >SB_2303| Best HMM Match : RVT_1 (HMM E-Value=7.9e-11) Length = 230 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 F D +K FD V HN L+ +L +GV++ L I FL+ R ++ G S P Sbjct: 55 FADFSKGFDLVDHNVLMSELDLLGVNEYLQNWIAAFLTARPQRVKISGHTSSP 107 >SB_54431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 32.7 bits (71), Expect = 0.33 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSRP 506 F D +K FD V HN L+ +L +GV++ L I FL+ R ++ G S P Sbjct: 718 FADFSKGFDLVDHNVLMPELDLLGVNEYLQNWIAAFLTARPQRVKISGHTSSP 770 >SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3) Length = 269 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 202 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 242 >SB_35790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.7 bits (71), Expect = 0.33 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 Query: 360 AKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 375 SKAFDSVPHQRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 421 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 32.7 bits (71), Expect = 0.33 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 Query: 360 AKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 617 SKAFDSVPHQRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 663 >SB_21602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 32.7 bits (71), Expect = 0.33 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 Query: 360 AKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 505 SKAFDSVPHQRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 551 >SB_15009| Best HMM Match : TP2 (HMM E-Value=3.3) Length = 151 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_9500| Best HMM Match : Saccharop_dh_N (HMM E-Value=1.8) Length = 109 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_5231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_5046| Best HMM Match : GST_N (HMM E-Value=2.5e-05) Length = 280 Score = 32.7 bits (71), Expect = 0.33 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 1/100 (1%) Frame = +3 Query: 129 YRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCKEVHC-LTEHI* 305 YRP+SL + + S +L H+ + D++ + RA HSC C + Sbjct: 85 YRPVSLTCIVCKLLEHIVYSNLML--HIDTYNILTDRQHAF-RASHSCLTQLCHVVNDWA 141 Query: 306 IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVS 425 + LN+ + T D AK FD V H L KL + G+S Sbjct: 142 LALNRG--LQTDAFILDFAKEFDSVPHERLKVKLRSYGIS 179 >SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) Length = 681 Score = 32.7 bits (71), Expect = 0.33 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +3 Query: 351 FDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRSR 503 FD +KAFD V H + KL + +S ++ I FL NR V+G ++ Sbjct: 530 FDFSKAFDSVSHEIVCRKLKSYDISPYVINWIVSFLGNRKQRVGVDGVSTK 580 >SB_59564| Best HMM Match : Vicilin_N (HMM E-Value=4.8) Length = 170 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_53833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_43442| Best HMM Match : BNR (HMM E-Value=0.00033) Length = 510 Score = 32.7 bits (71), Expect = 0.33 Identities = 22/59 (37%), Positives = 29/59 (49%) Frame = +1 Query: 385 ITV*FISCITWECLTDSCSSYETSYRTVRFHIE*RELALAPASDGRRHSGGRFCEHCSC 561 ITV F +T++CL S YE+ TV + A +GR HSGGR C+C Sbjct: 437 ITVDFEKLLTFKCLN---SDYESWVHTVAVKTK------AVCLEGRSHSGGRNLTRCTC 486 >SB_42770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_16475| Best HMM Match : Vicilin_N (HMM E-Value=1.6) Length = 153 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_12419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 + D+ KAFD V H L+ K+ +G+S + +I+ +LS R Sbjct: 10 VLLDLKKAFDTVDHEILLRKMQILGISHDALSLIKSYLSGR 50 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 32.7 bits (71), Expect = 0.33 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 Query: 360 AKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEGTRS 500 +KAFD V H L+ KL G+ ++ I+ F+SNR V GT S Sbjct: 3 SKAFDSVPHQRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVS 49 >SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 366 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEG 491 ++ D++KAFD+V H L KL G L+ +++NRS + G Sbjct: 117 VYLDMSKAFDRVSHRMLTRKLVQYGFGGNLLKWFTSYITNRSQRVAIPG 165 >SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 342 TLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNR 467 T+ FD KAFD + H+ L+ KL + + I DFL++R Sbjct: 768 TILFDFRKAFDLIDHHILVRKLMTYDLPSTITAWIVDFLTSR 809 >SB_42670| Best HMM Match : RVT_1 (HMM E-Value=5.6e-27) Length = 591 Score = 32.3 bits (70), Expect = 0.43 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +3 Query: 348 FFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRV 485 F D +K FD V HN L+ ++ + V + ++ I FLSNR P RV Sbjct: 266 FADFSKGFDLVDHNALVNEMKLLNVHNVIIRWICCFLSNR--PQRV 309 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 32.3 bits (70), Expect = 0.43 Identities = 33/127 (25%), Positives = 55/127 (43%), Gaps = 4/127 (3%) Frame = +3 Query: 96 FRYNTTITILRYRPISLLLSLDRQNIQTTPSETLLGLHLVQKDDDIDQRAVWVRAKHSCK 275 F+ + YR I+LL L + + T+ + L +LVQK + + R KHS Sbjct: 1336 FKKGDRSDVNNYRGITLLSCLSK--LFTSILNSRLYDYLVQKGY-LKKEQGGFRKKHSTV 1392 Query: 276 E----VHCLTEHI*IELNKRKLIPTGTLFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLI 443 + + + + + K+K T F D KAFD + + L K+ G+S + Sbjct: 1393 DSIFILKTVIDRVVKSKPKKKNNMLFTCFIDFRKAFDSIPRDKLFAKIQQSGISGNFYEV 1452 Query: 444 IRDFLSN 464 +R SN Sbjct: 1453 LRSMYSN 1459 >SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) Length = 1423 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEG 491 ++ D++KAFD+V H L KL G L+ +++NRS + G Sbjct: 1019 VYLDMSKAFDRVSHRMLTRKLVQYGFGGNLLKWFTSYITNRSQRVAIPG 1067 >SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 345 LFFDIAKAFDKVWHNGLIYKLYNMGVSD*LVLIIRDFLSNRSFPYRVEG 491 ++ D++KAFD+V H L KL G L+ +++NRS + G Sbjct: 631 VYLDMSKAFDRVSHRMLTRKLVQYGFGGNLLKWFTSYITNRSQRVAIPG 679 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,071,616 Number of Sequences: 59808 Number of extensions: 464534 Number of successful extensions: 1600 Number of sequences better than 10.0: 408 Number of HSP's better than 10.0 without gapping: 1493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1589 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -