SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00273
         (759 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0908 - 8823782-8826124                                           29   4.0  

>12_01_0908 - 8823782-8826124
          Length = 780

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = +2

Query: 167 VPQASAIVLVEPSTKSLAS-KLTHRHSPLSSRRSFQWVAL 283
           +P A A++L   +   LAS +L  RH PL  R +F W +L
Sbjct: 49  LPLAGALLLSYAALSDLASARLVLRHHPLRLRSAFLWNSL 88


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,796,826
Number of Sequences: 37544
Number of extensions: 335458
Number of successful extensions: 679
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 669
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 679
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2027850416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -