BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00273 (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 25 3.3 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 7.7 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 272 TEKIGENSVGCVCGLIYSPSSSSTVRLKRWLMLGVLKS 159 T+ IG + G C + +P+S + KR + L LKS Sbjct: 182 TDVIGSCAFGIECNTLENPNSQFRLMGKRMINLPKLKS 219 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 471 WCCVAFGNFYLSFYDVSVNLLN 406 W CV+ F+L YDV + +N Sbjct: 1050 WSCVSTPFFFLDEYDVFTDQVN 1071 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,544 Number of Sequences: 2352 Number of extensions: 13733 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -