BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00272 (754 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 25 0.86 AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 25 0.86 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.86 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.86 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 25 0.86 DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 24 1.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.0 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 24.6 bits (51), Expect = 0.86 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 253 GCSPNQVITNVGFFGKGST 197 GCSP ++I + F+G+ T Sbjct: 256 GCSPKKLIVGIPFYGRTFT 274 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 24.6 bits (51), Expect = 0.86 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +3 Query: 90 LQNYLRIRSVHPNVDYNECINFLKNEAEKIGLQVQVVEPLPKKPTLVMTWLGEQP 254 L+N L +R + V YN+ + + EK Q+ E P LV WL P Sbjct: 81 LENKLGVRQEN-RVKYNQNYSKVFGNDEKALEQIAKSEKEPSLTDLVQRWLERTP 134 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 24.6 bits (51), Expect = 0.86 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +3 Query: 90 LQNYLRIRSVHPNVDYNECINFLKNEAEKIGLQVQVVEPLPKKPTLVMTWLGEQP 254 L+N L +R + V YN+ + + EK Q+ E P LV WL P Sbjct: 141 LENKLGVRQEN-RVKYNQNYSKVFGNDEKALEQIAKSEKEPSLTDLVQRWLERTP 194 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 24.6 bits (51), Expect = 0.86 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +3 Query: 90 LQNYLRIRSVHPNVDYNECINFLKNEAEKIGLQVQVVEPLPKKPTLVMTWLGEQP 254 L+N L +R + V YN+ + + EK Q+ E P LV WL P Sbjct: 141 LENKLGVRQEN-RVKYNQNYSKVFGNDEKALEQIAKSEKEPSLTDLVQRWLERTP 194 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 24.6 bits (51), Expect = 0.86 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +1 Query: 484 DWWRYWNGEFVQTDVFKNMNVGFALDEGVAS 576 DWW ++ T ++KN EG+ S Sbjct: 97 DWWNELEAKYDPTGIYKNKYADELKAEGIVS 127 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 24.2 bits (50), Expect = 1.1 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Frame = +1 Query: 430 NRC-QAQKDCASVICT----RRGDWWRYWNGEFVQTDVFKNMNVGFALDEGV 570 ++C Q QKD + I + DWW ++ T ++KN EG+ Sbjct: 74 SKCSQRQKDGSRTIIRYLIKNKRDWWNELEAKYDPTGIYKNKYADELKAEGI 125 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 657 RFPSAPRQLRRKVAVHNRQVHG 722 R+PS P R A NR+++G Sbjct: 36 RYPSGPELSDRSAAYTNRELYG 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,064 Number of Sequences: 336 Number of extensions: 3998 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -