BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00269 (725 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Sch... 28 1.6 SPAC22F3.06c |lon1||Lon protease homolog Lon1|Schizosaccharomyce... 27 3.6 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 26 6.3 SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces p... 25 8.3 SPBC13E7.01 |cwf22|SPBC15D4.16|splicing factor Cwf22|Schizosacch... 25 8.3 >SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Schizosaccharomyces pombe|chr 1|||Manual Length = 738 Score = 27.9 bits (59), Expect = 1.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 465 AKICKDNTAHFENYIITFSNRTHRPRQC 548 +K+C+DN A E+ +IT + R QC Sbjct: 28 SKVCRDNIALSEHNVITVLDTPQRSTQC 55 >SPAC22F3.06c |lon1||Lon protease homolog Lon1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1067 Score = 26.6 bits (56), Expect = 3.6 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -2 Query: 688 APIRRTPSTTGFSKELIFMLDRHVGAFLVQRNNIVQFHVVTHAD 557 A + + PS + KELI ++GAFL++ N V+T+ D Sbjct: 179 AIVTKNPSVSEAIKELIKKRQPYIGAFLLKDEN-TDTDVITNID 221 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 327 PAFVSPTQSPYSVQPRRIQPP 265 P P QSP VQP QPP Sbjct: 1031 PMAADPFQSPLYVQPTGFQPP 1051 >SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 309 Score = 25.4 bits (53), Expect = 8.3 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 437 VPRYPVSCDREDMQRQHGPFRKLHHHVLKSNTSAETMCKIVGMCNNMKLD 586 +P++P R D+Q Q GP R L ++ S ++ + V + N+ +LD Sbjct: 9 LPKFPELKTR-DLQGQQGPIRSLGWNLSGSRLASSSSSGSVLVWNSDRLD 57 >SPBC13E7.01 |cwf22|SPBC15D4.16|splicing factor Cwf22|Schizosaccharomyces pombe|chr 2|||Manual Length = 834 Score = 25.4 bits (53), Expect = 8.3 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = +3 Query: 201 RLRDKYRRMC*GTTSMVRSLKRGAECGAVGHCTATVWEKQKPDVSDNEISSKFVKLFRGL 380 R R +YRR G+TS RS R + +V + P + + + F+ L G+ Sbjct: 739 RSRQRYRRSYAGSTSRGRSFSRSPSYRRRLSMSCSVSYSRSP----SPLHALFLALLLGI 794 Query: 381 KDVKDL 398 KD+ L Sbjct: 795 KDLMTL 800 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,119,712 Number of Sequences: 5004 Number of extensions: 67502 Number of successful extensions: 221 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -