BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00263 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 24 1.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 1.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 1.7 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 24 1.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 1.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 1.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 1.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 1.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 1.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 1.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 1.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 1.7 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 3.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 3.0 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 3.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 3.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 3.0 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 3.0 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 3.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 3.0 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 23 3.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.9 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 3.9 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 5.2 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 6.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.9 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 6.9 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 526 FSGAVSAKDFCVKMTSLSIRPHVKFWNRKPTSVNHVT 636 F G + + +KM RP F+N K + V+ +T Sbjct: 100 FLGPIKSLSLSIKMLERIWRPDTYFYNGKHSYVHTIT 136 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 171 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 204 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 171 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 204 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 171 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 204 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 1.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK + VN++K N S KKY +N Sbjct: 171 VLTKINKIKEHDTVLVVNIEKSENES---KKYATSSN 204 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK VN+KK N S KKY +N Sbjct: 182 VLTKINKIEEHDTVLVVNIKKSGNES---KKYATSSN 215 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 621 CQSCNRIGQYSCLRCKTCFCEE 686 C S G+YSCL+ F E Sbjct: 219 CNSKTNTGEYSCLKVDLLFKRE 240 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 621 CQSCNRIGQYSCLRCKTCFCEE 686 C S G+YSCL+ F E Sbjct: 219 CNSKTNTGEYSCLKVDLLFKRE 240 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK + VN++K N S KKY +N Sbjct: 182 VLTKINKIKEHDTVLVVNIEKSGNES---KKYATSSN 215 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK + VN++K N S KKY +N Sbjct: 182 VLTKINKIKEHDTVLVVNIEKSGNES---KKYATSSN 215 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK + VN++K N S KKY +N Sbjct: 182 VLTKINKIKEHDTVLVVNIEKSGNES---KKYATSSN 215 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK + VN++K N S KKY +N Sbjct: 187 VLTKINKIKEHDTVLVVNIEKSGNES---KKYATSSN 220 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK + VN++K N S KKY +N Sbjct: 182 VLTKINKIKEHDTVLVVNIEKSGNES---KKYATSSN 215 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 72 VVTSVNKTRTCQRKRPVNVKKQRNRSCARKKYGPLAN 182 V+T +NK + VN++K N S KKY +N Sbjct: 182 VLTKINKIKEHDTVLVVNIEKSGNES---KKYATSSN 215 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 Query: 95 CFIYRCNNVHNWILRSKSSKNMH*SLKLM 9 C C +V + I + KSSKN+ S+ ++ Sbjct: 10 CLSIACQDVTSAIHQRKSSKNLEHSMNVI 38 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +1 Query: 142 TEVAPERNTGRSRTCRFSSTSL*RCYGVRQMSEKTEDTAFC 264 TE A ++G S TC S + + + S ++E + +C Sbjct: 7 TENAKVSDSGYSNTCSNSQSQRSSGSSISRNSNRSESSGYC 47 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +1 Query: 142 TEVAPERNTGRSRTCRFSSTSL*RCYGVRQMSEKTEDTAFC 264 TE A ++G S TC S + + + S ++E + +C Sbjct: 7 TENAKVSDSGYSNTCSNSQSQRSSGSSISRNSNRSESSGYC 47 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 277 AVQRLPTCAHCGKVKC 324 + ++L TC CGKV C Sbjct: 1 SAKKLFTCQLCGKVLC 16 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 203 PCNVAMECDKCQKKQKTLHFATSVKLY 283 P ++ C+KC +KQK H A V Y Sbjct: 65 PDALSTGCNKCNEKQK--HTANKVVNY 89 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 4/20 (20%) Frame = +1 Query: 460 TCPLMDAVC----LECERGV 507 TC +MDA+C +C+ GV Sbjct: 637 TCNIMDAICTKLTADCQPGV 656 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 203 PCNVAMECDKCQKKQKTLHFATSVKLY 283 P ++ C+KC +KQK H A V Y Sbjct: 65 PDALSTGCNKCNEKQK--HTANKVVNY 89 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,733 Number of Sequences: 438 Number of extensions: 5312 Number of successful extensions: 34 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -