BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00258 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20443| Best HMM Match : Sugar_tr (HMM E-Value=3.5) 31 0.99 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_20443| Best HMM Match : Sugar_tr (HMM E-Value=3.5) Length = 563 Score = 31.1 bits (67), Expect = 0.99 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 390 CVSTGDYDKAVTITKSLQDDNVGFMIE 470 C+S GD+++A++I K++ DN G + E Sbjct: 313 CISAGDHERALSILKTIAKDNKGTLPE 339 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +3 Query: 33 ARHGSQDPQQDPGARRKRLRHPGLH-QG*LGQNSDAHERAHHSEQRQR 173 ARHGSQD QDPG + PG H G N++ + R H +R+R Sbjct: 595 ARHGSQDQAQDPGDQ------PGAHPSGQFLFNAECYHR--HCSRRRR 634 >SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1276 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 94 TRAYIKDDSVKIVTLMSAPIIPNSARDITRIVNERVGMV 210 T KDDSV V + I+P S++ +T V E G V Sbjct: 206 TTTETKDDSVTDVNTKKSAILPESSQAVTDQVEENDGSV 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,498,804 Number of Sequences: 59808 Number of extensions: 455877 Number of successful extensions: 1277 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -