BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00258 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.3 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.3 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 5.3 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 7.0 DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. 22 7.0 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 22 7.0 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = +2 Query: 626 YYN--QALKLDSNVDSYNNRLA 685 +YN QA +++N+DSY N A Sbjct: 57 WYNEGQAWNIEANIDSYTNAAA 78 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = +2 Query: 626 YYN--QALKLDSNVDSYNNRLA 685 +YN QA +++N+DSY N A Sbjct: 57 WYNEGQAWNIEANIDSYTNAAA 78 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +2 Query: 596 KQERVKIIGRYYNQALKLDSNVDSYNNR 679 + + KII N+ + ++N ++YNN+ Sbjct: 297 RSKEPKIISSLSNKTIHNNNNYNNYNNK 324 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -3 Query: 225 HAVYDDHAHAFVNDSRNVSGAVRNDGRAHERH 130 H ++ H H ++ S A + +AHE+H Sbjct: 170 HQMHTQHPHMQPQQGQHQSQAQQQHLQAHEQH 201 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/43 (27%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 67 PVRDENDCDTRAYIKDDSVKIVTLMSAPIIPNSA-RDITRIVN 192 P+R +DC T + + D +V L +S R + IV+ Sbjct: 419 PIRKISDCSTTSSLSGDESDVVELQPVKSSKSSGWRKLRNIVH 461 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/22 (36%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 123 QNSDAH-ERAHHSEQRQRHYEN 185 QN++ H ++AHHS + + N Sbjct: 441 QNNNQHNDQAHHSSKSNNRHNN 462 >DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. Length = 135 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 406 SPVDTHLKSRSIRSCLLRKATCESII 329 S D HLKS + C + T + I+ Sbjct: 108 SDADIHLKSSKLIKCFAKYKTLKEIM 133 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 351 FLNKQLLMDLLFKCVSTGDYDKAVTITKSLQ 443 FLN+ + L+ +C + D + + ITK Q Sbjct: 91 FLNENEINQLITECSAISDTNVHLKITKIFQ 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,813 Number of Sequences: 438 Number of extensions: 4189 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -