BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00253 (743 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69384-5|CAA93419.2| 408|Caenorhabditis elegans Hypothetical pr... 93 2e-19 U80452-13|AAB37850.1| 139|Caenorhabditis elegans Hypothetical p... 28 8.0 >Z69384-5|CAA93419.2| 408|Caenorhabditis elegans Hypothetical protein T11G6.8 protein. Length = 408 Score = 92.7 bits (220), Expect = 2e-19 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 1/52 (1%) Frame = +2 Query: 590 MATSKST-NTYNRQNWEDADFPILCQTCLGDNPYIRMTKEKYGKECKICSRP 742 M+ SKS+ + YNR+NWED+DFPILC+TCLG+NPY+RM K+KYG+ECKIC RP Sbjct: 1 MSMSKSSYSQYNRKNWEDSDFPILCETCLGNNPYMRMMKDKYGRECKICERP 52 >U80452-13|AAB37850.1| 139|Caenorhabditis elegans Hypothetical protein C16C8.8 protein. Length = 139 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 586 VSFLDIILDSTQLNLSNKTLLSHFYMN*ITKVFTGAEFGTRIST 455 V +D +L S+ NLS+K ++ FY TK+ G I+T Sbjct: 51 VRVMDSLLLSSNENLSSKNMIREFYKYPNTKIHDARFVGRNIAT 94 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,842,451 Number of Sequences: 27780 Number of extensions: 320921 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -