BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00249 (747 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 4.3 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 23 7.6 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +2 Query: 572 KTQTAFSTKMVFADATSINNHLYNLVTGGDYINAVKTVRS 691 +T F+ V + INN +T G+ + A+K +S Sbjct: 419 QTDDTFTCTRVIPEDCEINNGCMEEITSGEILYAIKNSQS 458 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 698 DNQGSDVCRDVVSRLV 745 D +GSD+C +VV R V Sbjct: 72 DMEGSDICFEVVRRAV 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,189 Number of Sequences: 2352 Number of extensions: 15415 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -