BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00248X (562 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 24 3.0 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 24 3.9 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 5.2 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 6.8 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 6.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 6.8 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 24.2 bits (50), Expect = 3.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 299 SFELPESNIDCDTKLRSAFSLSNT 228 +F LP+SN +C T R S NT Sbjct: 142 NFHLPKSNRNCRTAARRNHSSRNT 165 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.8 bits (49), Expect = 3.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 464 LARFHPRCQTAHRRSNKMDSTEPP 535 L R+ +TAHR + MD++ P Sbjct: 36 LGRYELEKETAHRMAESMDTSHKP 59 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 5.2 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 217 KYAWVLDKLKAERSLVSQSILLSGSSKLASTMLPSL 324 KYAW L K +RS+ L SSK S ML +L Sbjct: 188 KYAWALPMHKKQRSMYDLIGQLVQSSK--SPMLQTL 221 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.0 bits (47), Expect = 6.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 467 ARFHPRCQTAHRRSNKMDSTEPPYS 541 ARF P T+HR S+ S+ P S Sbjct: 344 ARFDPSALTSHRSSSANCSSAAPKS 368 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 6.8 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 285 WKFETSKYYVTIIDAPG 335 W +E K+ T+I+ PG Sbjct: 487 WNYEDYKFRTTVINMPG 503 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 6.8 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -1 Query: 487 TPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVP 365 T R AS S P IPA + PVPA QS +P Sbjct: 354 TSRPVASGPTSHYYPS-HIPAGSQPVPAVVNPHQQSRPTIP 393 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 585,042 Number of Sequences: 2352 Number of extensions: 11708 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -