BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00237 (453 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 4.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.1 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.1 Identities = 6/17 (35%), Positives = 14/17 (82%) Frame = +1 Query: 31 NINKMSYLTRKIALIPR 81 N+N +S+ TR++ ++P+ Sbjct: 1026 NMNNVSWGTREVTVVPK 1042 Score = 20.2 bits (40), Expect = 9.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 203 SKDNTVLKMPDLDEVKRAP*MKPEFARKQLSNL 301 +++ TV+ PD + V++ KPE K L+ L Sbjct: 1034 TREVTVVPKPDPNAVQKIEEKKPEKKDKVLTFL 1066 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.1 Identities = 6/17 (35%), Positives = 14/17 (82%) Frame = +1 Query: 31 NINKMSYLTRKIALIPR 81 N+N +S+ TR++ ++P+ Sbjct: 1026 NMNNVSWGTREVTVVPK 1042 Score = 20.2 bits (40), Expect = 9.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 203 SKDNTVLKMPDLDEVKRAP*MKPEFARKQLSNL 301 +++ TV+ PD + V++ KPE K L+ L Sbjct: 1034 TREVTVVPKPDPNAVQKIEEKKPEKKDKVLTFL 1066 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 7.1 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -1 Query: 210 SLLVSSGKALELLVRKIIVLMKSYN 136 S +VSS +R I +K YN Sbjct: 265 STMVSSANRRREFIRSAITFIKQYN 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,874 Number of Sequences: 336 Number of extensions: 1877 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10301074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -