BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00237 (453 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0591 + 4261483-4261631,4261837-4262007,4262127-4262226,426... 31 0.43 07_01_0042 - 334417-334431,334563-334688,334852-335136,335220-33... 31 0.57 06_01_0988 - 7660092-7660168,7660260-7660328,7660418-7660462,766... 28 4.0 03_05_1111 - 30479793-30479823,30479887-30479978,30480261-304804... 27 7.1 >06_01_0591 + 4261483-4261631,4261837-4262007,4262127-4262226, 4263151-4263315,4263416-4263544,4263758-4263858, 4264527-4264596,4265080-4265331,4265828-4265897, 4266281-4266341,4266916-4267003,4267746-4267830, 4268168-4268234,4268442-4268559,4268843-4268923, 4269022-4269267,4269670-4269771,4269847-4269914, 4270040-4270171,4270283-4270430,4270504-4270790, 4270920-4271067,4271156-4271331,4271407-4271518, 4271614-4271667,4273134-4273244,4273317-4273478, 4273627-4273814,4273948-4274137,4274297-4274464, 4274832-4274912 Length = 1359 Score = 31.1 bits (67), Expect = 0.43 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 287 QLSNLTLTTEHRWYPRARDKKGQKTGMD*PYLEPSYFYWYRC-NIACF 427 +L T R R RD G+ TG D P + P Y W+R N+ F Sbjct: 29 ELRGAETTRVERRRERRRDALGRGTGGDSPRVSPIYILWFRSRNLVVF 76 >07_01_0042 - 334417-334431,334563-334688,334852-335136,335220-335368, 336239-336536,337030-337131,337245-337613,337973-338115, 338334-338518,339246-339475,339734-339821,340158-340253, 340397-340512,340604-340852,340950-341175,341411-341622 Length = 962 Score = 30.7 bits (66), Expect = 0.57 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = -3 Query: 232 RHFQNCIIFTCLFW*SS*IARKENHSLDEELQW*SHRQ*SLFYCRIYLMP---LLGLMLF 62 RH +I CLF+ SS H LD ++W S + + +Y +P +G+ + Sbjct: 36 RHIMTAVIIACLFFISSDNMHTLIHKLDNNIKWWSMYVAWICFASLYHLPSFQSMGVDMR 95 Query: 61 CELNRTFYLYF 29 L+ +YF Sbjct: 96 MNLSLFLTIYF 106 >06_01_0988 - 7660092-7660168,7660260-7660328,7660418-7660462, 7660683-7660767,7660930-7661041,7661113-7661228, 7661325-7661495,7661572-7661703,7662278-7662366, 7662761-7662824,7663043-7663148,7663507-7663613, 7663744-7663797,7664105-7664226,7664593-7664748, 7664861-7665059 Length = 567 Score = 27.9 bits (59), Expect = 4.0 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = -1 Query: 432 EVKQAILHLYQ*K*EGSK*GQSIPVFWPFLSRALGYH-RCSVVNVRFDSCFLANSGFIHG 256 E ++ ++ + + + E K P + S GY RC + + FDS + G+ G Sbjct: 405 ETEKMLIAMVETELEKRKAEGKYPAHFRGQSHFFGYEGRCGLPTI-FDSNYCYALGYGSG 463 Query: 255 ALLTSSKSGIFKTVLSL 205 ALL K+G+ +V +L Sbjct: 464 ALLQCGKTGLITSVGNL 480 >03_05_1111 - 30479793-30479823,30479887-30479978,30480261-30480410, 30482229-30482354,30482563-30482628,30483134-30483214, 30483310-30483422,30483553-30483721,30484253-30484330, 30485489-30485752,30486239-30486379,30486548-30486759, 30486819-30486940,30487281-30487398,30487925-30487997 Length = 611 Score = 27.1 bits (57), Expect = 7.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 305 LTTEHRWYPRARDKK 349 LT H WYP AR+KK Sbjct: 63 LTHPHIWYPNAREKK 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,874,863 Number of Sequences: 37544 Number of extensions: 170921 Number of successful extensions: 393 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -