BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00237 (453 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 23 3.8 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 23 5.0 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.4 bits (48), Expect = 3.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 124 DGSTIVALHQDYDFPYEQFKSFTRR 198 DG+ + LH+ D P E SF+ R Sbjct: 182 DGALLANLHRQLDPPGEDLASFSLR 206 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 23.0 bits (47), Expect = 5.0 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -1 Query: 312 VVNVRFDSCFLANSGFIHGALLTSSKSGIFKTVLSLLVSSGKALELL 172 +V V F CFL +GFI + + + + L++ + +GK EL+ Sbjct: 118 LVMVCFVKCFLDKAGFIDDDGVI--QQDVIREKLTVGIEAGKVNELI 162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 403,014 Number of Sequences: 2352 Number of extensions: 6576 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -