BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00233X (368 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 2.3 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 2.3 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 4.0 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 20 7.0 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 20 9.2 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 20 9.2 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 98 VXVWQSRQLTRMHRAPRPTRPDKARRLGYRAK 193 + +WQS + + R+ + + P K L RAK Sbjct: 228 IEIWQSSESSLRPRSSQKSAPGKRTPLISRAK 259 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 88 KTHNIAQFFPIQLLNISVGTHLS 20 + H + FPI L ISV T L+ Sbjct: 386 RQHAVTAKFPIYLYRISVETKLN 408 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.0 bits (42), Expect = 4.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 2 RRLPQAAKMGAY 37 +R+PQ AK GAY Sbjct: 287 QRVPQLAKNGAY 298 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 20.2 bits (40), Expect = 7.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 233 HHVAHGF*IQHNLV*H 186 HH H QH++V H Sbjct: 324 HHAGHHIHAQHHVVNH 339 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 19.8 bits (39), Expect = 9.2 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 48 RSCIGKN*AML 80 R+CIGK AML Sbjct: 449 RNCIGKKFAML 459 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 19.8 bits (39), Expect = 9.2 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 48 RSCIGKN*AML 80 R+CIGK AML Sbjct: 449 RNCIGKKFAML 459 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,776 Number of Sequences: 336 Number of extensions: 1905 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7616520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -