BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00231 (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 4.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 6.2 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 446 YQATMIFYM*KGAEMFQAHVK 508 Y+ ++FY KG QAH K Sbjct: 8 YRHILLFYFRKGKNASQAHKK 28 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 234 LNIKALNVNLKIRAELLFGCYFNVVTNCKHNVGE 133 L + N+N +R E Y + + NC+ GE Sbjct: 442 LYFRCSNLNHMMREEFYQSQYGDPINNCEIKAGE 475 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,404 Number of Sequences: 438 Number of extensions: 3548 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -