BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00230 (825 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.09 |sec62||ER protein translocation subcomplex subunit ... 26 5.6 SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 26 7.5 >SPAC17G6.09 |sec62||ER protein translocation subcomplex subunit Sec62 |Schizosaccharomyces pombe|chr 1|||Manual Length = 273 Score = 26.2 bits (55), Expect = 5.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 405 YCVPAVSIQEYIFLYHSLLVDEFFC 479 +C+ AV ++ I+L+ +LL D FC Sbjct: 186 FCITAVIVRPGIWLFPNLLADVGFC 210 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 25.8 bits (54), Expect = 7.5 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 246 KNYLFFIFLVEFQF-IYFSIFFKNIELSPVLNKYSKFR 136 + +L F+F + IYF + F ++ P+ KY +R Sbjct: 443 RTFLLFVFTLSTLIPIYFYVAFYYLQNIPIQKKYESYR 480 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,718,281 Number of Sequences: 5004 Number of extensions: 49651 Number of successful extensions: 125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 404442380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -