BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00230 (825 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49070.1 68418.m06072 beta-ketoacyl-CoA synthase family prote... 29 3.7 >At5g49070.1 68418.m06072 beta-ketoacyl-CoA synthase family protein similar to very-long-chain fatty acid condensing enzyme CUT1 [GI:5001734], beta-ketoacyl-CoA synthase [Simmondsia chinensis][GI:1045614] Length = 464 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = -2 Query: 104 HVQRFRYILTHIRLKLIKAY*NISNY*LNFR 12 ++++F+Y++ HI K +K Y + S+Y NF+ Sbjct: 317 YLEQFQYVIQHILCKKLKIYESNSSYTPNFK 347 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,961,803 Number of Sequences: 28952 Number of extensions: 218527 Number of successful extensions: 433 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1892353600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -