BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00222X (492 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 25 0.44 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 24 1.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 4.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.4 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 25.0 bits (52), Expect = 0.44 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 215 WMP*SKH-LRIWRSTQPDPAVELIKQRLSNVKHKIL 319 WMP + ++ W QP+P +ELI+ + + + IL Sbjct: 476 WMPSIRGAIQQWTCRQPEPLIELIEHWMPLLPNWIL 511 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.8 bits (49), Expect = 1.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 Query: 290 VVLSVLLRGQVECF 249 V+++VLL GQV CF Sbjct: 13 VIINVLLHGQVICF 26 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 310 VLYIGETLFYQFYCGVRLSAS 248 VL I + L YCG+R S Sbjct: 675 VLLISDRLSRDLYCGIRAGLS 695 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 310 VLYIGETLFYQFYCGVRLSAS 248 VL I + L YCG+R S Sbjct: 713 VLLISDRLSRDLYCGIRAGLS 733 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 464 GRPVLAAGSGRR 429 G PV+ AG GRR Sbjct: 578 GVPVVGAGGGRR 589 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,509 Number of Sequences: 438 Number of extensions: 3274 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -