BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00222X (492 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50960.1 68418.m06320 nucleotide-binding family protein simil... 94 5e-20 At4g19540.1 68417.m02874 expressed protein 50 6e-07 At3g24430.1 68416.m03066 expressed protein contains Pfam profile... 49 2e-06 At5g24020.1 68418.m02822 septum site-determining protein (MIND) ... 34 0.045 At5g05000.3 68418.m00531 translocate of chloroplast 34 (TOC34) /... 34 0.045 At5g05000.2 68418.m00530 translocate of chloroplast 34 (TOC34) /... 34 0.045 At5g05000.1 68418.m00529 translocate of chloroplast 34 (TOC34) /... 34 0.045 At5g47250.1 68418.m05826 disease resistance protein (CC-NBS-LRR ... 33 0.10 At1g02280.1 68414.m00169 GTP-binding protein (TOC33) identical t... 33 0.10 At3g54950.1 68416.m06092 patatin-related low similarity to patat... 33 0.14 At5g43470.2 68418.m05315 disease resistance protein (CC-NBS-LRR ... 31 0.56 At5g43470.1 68418.m05314 disease resistance protein (CC-NBS-LRR ... 31 0.56 At5g63020.1 68418.m07906 disease resistance protein (CC-NBS-LRR ... 30 0.74 At3g10350.1 68416.m01241 anion-transporting ATPase family protei... 30 0.74 At2g32850.2 68415.m04025 protein kinase family protein contains ... 30 0.74 At2g32850.1 68415.m04024 protein kinase family protein contains ... 30 0.74 At1g51480.1 68414.m05794 disease resistance protein (CC-NBS-LRR ... 30 0.74 At1g01910.2 68414.m00109 anion-transporting ATPase, putative sim... 30 0.74 At1g01910.1 68414.m00108 anion-transporting ATPase, putative sim... 30 0.74 At5g25420.1 68418.m03016 xanthine/uracil permease family protein... 29 2.2 At1g71890.1 68414.m08311 sucrose transporter / sucrose-proton sy... 28 3.0 At1g53350.1 68414.m06048 disease resistance protein (CC-NBS-LRR ... 28 3.0 At5g48620.1 68418.m06013 disease resistance protein (CC-NBS-LRR ... 28 3.9 At5g04310.1 68418.m00423 pectate lyase family protein similar to... 28 3.9 At4g25750.1 68417.m03707 ABC transporter family protein Bactroce... 28 3.9 At1g61300.1 68414.m06909 disease resistance protein (NBS-LRR cla... 28 3.9 At1g55620.2 68414.m06367 voltage-gated chloride channel family p... 28 3.9 At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR ... 27 5.2 At1g66090.1 68414.m07501 disease resistance protein (TIR-NBS cla... 27 5.2 At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR... 27 5.2 At4g20910.1 68417.m03031 double-stranded RNA binding protein-rel... 27 6.9 At2g16790.1 68415.m01925 shikimate kinase family protein similar... 27 6.9 At1g75290.1 68414.m08746 isoflavone reductase, putative similar ... 27 6.9 At5g59500.1 68418.m07457 expressed protein 27 9.1 At5g43740.2 68418.m05348 disease resistance protein (CC-NBS-LRR ... 27 9.1 At5g43740.1 68418.m05347 disease resistance protein (CC-NBS-LRR ... 27 9.1 At5g17970.1 68418.m02108 disease resistance protein (TIR-NBS-LRR... 27 9.1 At1g64070.1 68414.m07258 disease resistance protein (TIR-NBS-LRR... 27 9.1 At1g03030.1 68414.m00275 phosphoribulokinase/uridine kinase fami... 27 9.1 >At5g50960.1 68418.m06320 nucleotide-binding family protein similar to Nucleotide-binding protein 1 (NBP 1) (SP:Q9R060) [Mus musculus]; contains Pfam PF00991 : ParA family ATPase Length = 350 Score = 93.9 bits (223), Expect = 5e-20 Identities = 42/76 (55%), Positives = 57/76 (75%) Frame = +2 Query: 260 PDPAVELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILDADICGP 439 PDP + I +R+S VKHKIL+LSGKGGVGKST ++ + LA M D VG++D DICGP Sbjct: 44 PDPDLVAIAERMSTVKHKILVLSGKGGVGKSTFSAQLSFALAGM--DHQVGLMDIDICGP 101 Query: 440 SQPRVLGVRGEQVHNS 487 S P++LG+ G+++H S Sbjct: 102 SIPKMLGLEGQEIHQS 117 Score = 58.8 bits (136), Expect = 2e-09 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = +3 Query: 144 VPDNAPQHCPGTQSEDAGKASACAGCPNQNICAS 245 +P++A +HCPG QSE AGK+ +CAGCPNQ CA+ Sbjct: 6 IPEDANEHCPGPQSESAGKSDSCAGCPNQEACAT 39 >At4g19540.1 68417.m02874 expressed protein Length = 313 Score = 50.4 bits (115), Expect = 6e-07 Identities = 26/77 (33%), Positives = 42/77 (54%) Frame = +2 Query: 233 HLRIWRSTQPDPAVELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVG 412 H+ ++ + + RL VK I + SGKGGVGKS+ + LA+ + +G Sbjct: 19 HISAYKFSSASAGGRTTELRLHGVKDIIAVASGKGGVGKSSTAVNLAVALANKC-ELKIG 77 Query: 413 ILDADICGPSQPRVLGV 463 +LDAD+ GPS P ++ + Sbjct: 78 LLDADVYGPSVPIMMNI 94 >At3g24430.1 68416.m03066 expressed protein contains Pfam profile PF01883: Domain of unknown function Length = 532 Score = 48.8 bits (111), Expect = 2e-06 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +2 Query: 218 MP*SKHLRIWRSTQPDPAVEL--IKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASM 391 +P K + + S QP + + LS + + I + S KGGVGKSTV + + LA M Sbjct: 145 LPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVNLAYTLAGM 204 Query: 392 SPDRNVGILDADICGPSQPRVL 457 VGI DAD+ GPS P ++ Sbjct: 205 G--ARVGIFDADVYGPSLPTMV 224 >At5g24020.1 68418.m02822 septum site-determining protein (MIND) identical to MinD [Arabidopsis thaliana] GI:6759277; contains Pfam PF00991 : ParA family ATPase Length = 326 Score = 34.3 bits (75), Expect = 0.045 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +2 Query: 314 ILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILDADI 430 ++I SGKGGVGK+T T+ +G LA +V +DAD+ Sbjct: 61 VVITSGKGGVGKTTTTANVGLSLARYG--FSVVAIDADL 97 >At5g05000.3 68418.m00531 translocate of chloroplast 34 (TOC34) / GTP-binding protein (OEP34) contains Pfam PF04548: AIG1 family;contains TIGRFAM TIGR00991: GTP-binding protein and TIGR00231: small GTP-binding protein domain; 99.7% identical to atToc34 protein (GI:11557975) [Arabidopsis thaliana]; similar to Chain A, Pea Toc34 - A Novel Gtpase Of The Chloroplast Protein Translocon (GI:1865556) [Pisum sativum]; almost identical to SP:Q38906 Translocase of chloroplast 34; identical to cDNA GTP-binding protein (OEP34) GI:1151243 Length = 313 Score = 34.3 bits (75), Expect = 0.045 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +2 Query: 284 KQRLSNVKHKILILSGKGGVGK-STVTSIIGHGLASMSPDRNVGI 415 K + +V +++ GKGGVGK STV S+IG A++S ++ G+ Sbjct: 30 KYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGL 74 >At5g05000.2 68418.m00530 translocate of chloroplast 34 (TOC34) / GTP-binding protein (OEP34) contains Pfam PF04548: AIG1 family;contains TIGRFAM TIGR00991: GTP-binding protein and TIGR00231: small GTP-binding protein domain; 99.7% identical to atToc34 protein (GI:11557975) [Arabidopsis thaliana]; similar to Chain A, Pea Toc34 - A Novel Gtpase Of The Chloroplast Protein Translocon (GI:1865556) [Pisum sativum]; almost identical to SP:Q38906 Translocase of chloroplast 34; identical to cDNA GTP-binding protein (OEP34) GI:1151243 Length = 313 Score = 34.3 bits (75), Expect = 0.045 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +2 Query: 284 KQRLSNVKHKILILSGKGGVGK-STVTSIIGHGLASMSPDRNVGI 415 K + +V +++ GKGGVGK STV S+IG A++S ++ G+ Sbjct: 30 KYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGL 74 >At5g05000.1 68418.m00529 translocate of chloroplast 34 (TOC34) / GTP-binding protein (OEP34) contains Pfam PF04548: AIG1 family;contains TIGRFAM TIGR00991: GTP-binding protein and TIGR00231: small GTP-binding protein domain; 99.7% identical to atToc34 protein (GI:11557975) [Arabidopsis thaliana]; similar to Chain A, Pea Toc34 - A Novel Gtpase Of The Chloroplast Protein Translocon (GI:1865556) [Pisum sativum]; almost identical to SP:Q38906 Translocase of chloroplast 34; identical to cDNA GTP-binding protein (OEP34) GI:1151243 Length = 313 Score = 34.3 bits (75), Expect = 0.045 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +2 Query: 284 KQRLSNVKHKILILSGKGGVGK-STVTSIIGHGLASMSPDRNVGI 415 K + +V +++ GKGGVGK STV S+IG A++S ++ G+ Sbjct: 30 KYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGL 74 >At5g47250.1 68418.m05826 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 843 Score = 33.1 bits (72), Expect = 0.10 Identities = 19/73 (26%), Positives = 37/73 (50%) Frame = +2 Query: 263 DPAVELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILDADICGPS 442 D +E + L ++++L + G GGVGK+T+ ++I + +S D +V I Sbjct: 161 DTTLEKTWESLRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVIWVESSKDAD 220 Query: 443 QPRVLGVRGEQVH 481 ++ GE++H Sbjct: 221 VGKIQDAIGERLH 233 >At1g02280.1 68414.m00169 GTP-binding protein (TOC33) identical to atToc33 protein (GI:11557973) [Arabidopsis thaliana]; Carboxyl-terminal end highly similar to GTP-binding protein SP:U43377, location of EST gb|AA394770 and gb|R30089; identical to cDNA for chloroplast atToc33 protein GI:11557972 Length = 297 Score = 33.1 bits (72), Expect = 0.10 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +2 Query: 284 KQRLSNVKHKILILSGKGGVGKS-TVTSIIGHGLASMSPDRNVGI 415 K + ++ +++ GKGGVGKS TV S+IG + +SP + G+ Sbjct: 28 KLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFQAEGL 72 >At3g54950.1 68416.m06092 patatin-related low similarity to patatin [GI:169500][Solanum tuberosum]; contains Patatin domain PF01734 Length = 488 Score = 32.7 bits (71), Expect = 0.14 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +2 Query: 227 SKHLRIWRSTQPDPAVELIKQRLSNVKHKILILS----GKGGVGKSTVTSIIGHGLASMS 394 SK L + ++P+PA ++ + N + KI ILS G G+ + + H L S S Sbjct: 69 SKFLFGYDDSKPEPANSVVAGSIKNQRGKICILSIDGGGMRGILPGKALAYLEHALKSKS 128 Query: 395 PDRNVGILD 421 D N I D Sbjct: 129 GDPNARIAD 137 >At5g43470.2 68418.m05315 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Closest Col-0 homolog to RPP8 Length = 908 Score = 30.7 bits (66), Expect = 0.56 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 275 ELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGH 376 EL+ + N H+++ ++G GG+GK+T+ + H Sbjct: 174 ELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFH 207 >At5g43470.1 68418.m05314 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Closest Col-0 homolog to RPP8 Length = 908 Score = 30.7 bits (66), Expect = 0.56 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 275 ELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGH 376 EL+ + N H+++ ++G GG+GK+T+ + H Sbjct: 174 ELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFH 207 >At5g63020.1 68418.m07906 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 888 Score = 30.3 bits (65), Expect = 0.74 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +2 Query: 263 DPAVELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGI 415 DP +E RL + IL L G GGVGK+T+ S I + + + + ++ I Sbjct: 159 DPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVI 209 >At3g10350.1 68416.m01241 anion-transporting ATPase family protein similar to SP|O43681 Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) (ASNA-I) {Homo sapiens}; contains Pfam profile PF02374: Anion-transporting ATPase; contains non-consensus GA donor splice site at intron 5 Length = 411 Score = 30.3 bits (65), Expect = 0.74 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 236 LRIWRSTQPDPAVELIKQRLSNVKHKILILSGKGGVGKST 355 L++ P + + +S K K +L GKGGVGK++ Sbjct: 63 LQVKSVASPTETISEFDEMVSGTKRKYYMLGGKGGVGKTS 102 >At2g32850.2 68415.m04025 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 670 Score = 30.3 bits (65), Expect = 0.74 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +2 Query: 284 KQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILDADICGPSQPRVLGV 463 ++ L V +I +L K G V ++ HG+ M ++ +L D CG S VL Sbjct: 64 EESLELVMKEISVL--KSLKGHPNVVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLEN 121 Query: 464 RG 469 RG Sbjct: 122 RG 123 >At2g32850.1 68415.m04024 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 650 Score = 30.3 bits (65), Expect = 0.74 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +2 Query: 284 KQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILDADICGPSQPRVLGV 463 ++ L V +I +L K G V ++ HG+ M ++ +L D CG S VL Sbjct: 64 EESLELVMKEISVL--KSLKGHPNVVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLEN 121 Query: 464 RG 469 RG Sbjct: 122 RG 123 >At1g51480.1 68414.m05794 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 941 Score = 30.3 bits (65), Expect = 0.74 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +2 Query: 272 VELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGI 415 VE+ + L N + + L L G GGVGK+T+ + I + + + +V I Sbjct: 248 VEMAWKSLMNDEIRTLCLHGMGGVGKTTLLACINNKFVELESEFDVVI 295 >At1g01910.2 68414.m00109 anion-transporting ATPase, putative similar to SP|O43681 Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) (ASNA-I) {Homo sapiens}; contains Pfam profile PF02374: Anion-transporting ATPase Length = 353 Score = 30.3 bits (65), Expect = 0.74 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +2 Query: 311 KILILSGKGGVGKSTVTSIIGHGLASM 391 K + + GKGGVGK+T +SI+ LAS+ Sbjct: 20 KWVFVGGKGGVGKTTCSSILAICLASV 46 >At1g01910.1 68414.m00108 anion-transporting ATPase, putative similar to SP|O43681 Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) (ASNA-I) {Homo sapiens}; contains Pfam profile PF02374: Anion-transporting ATPase Length = 353 Score = 30.3 bits (65), Expect = 0.74 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +2 Query: 311 KILILSGKGGVGKSTVTSIIGHGLASM 391 K + + GKGGVGK+T +SI+ LAS+ Sbjct: 20 KWVFVGGKGGVGKTTCSSILAICLASV 46 >At5g25420.1 68418.m03016 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 419 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 435 PQMSASSIPTFLSGLIDARPCPIIDVTVLF 346 PQ + +S T +GLI PCP D+T F Sbjct: 245 PQTTQTSCRTDRTGLITNTPCPTFDITDSF 274 >At1g71890.1 68414.m08311 sucrose transporter / sucrose-proton symporter (SUC5) nearly identical to sucrose transporter [Arabidopsis thaliana] GI:12057172 Length = 512 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -1 Query: 447 GWLGPQMSASSIPTFLSGLIDARPCPIIDVTVLFPTPPLPD 325 G L Q ++P+F+ G I A ++ +TVL P+PP PD Sbjct: 463 GPLDAQFGGGNLPSFVVGAIAAAVSGVLALTVL-PSPP-PD 501 >At1g53350.1 68414.m06048 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 906 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 275 ELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGH 376 EL+ + N +++ +SG GG+GK+T+ + H Sbjct: 172 ELVDHLVENDSVQVVSVSGMGGIGKTTLARQVFH 205 >At5g48620.1 68418.m06013 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 908 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +2 Query: 275 ELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGH 376 EL+ + N ++++ ++G GG+GK+T+ + H Sbjct: 174 ELVGHLVENDIYQVVSIAGMGGIGKTTLARQVFH 207 >At5g04310.1 68418.m00423 pectate lyase family protein similar to pectate lyase GP:14531296 from [Fragaria x ananassa] Length = 518 Score = 27.9 bits (59), Expect = 3.9 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = +2 Query: 257 QPDPAVELIKQRLS-NVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILDADI- 430 QP+P + + +KH+++I S K G+ T I GHG ++ +V I + I Sbjct: 158 QPEPLWIIFSSDMGIKLKHELIIGSYKTIDGRGTNIQITGHGCLTIQQVSHVIIHNVHIH 217 Query: 431 -CGPS 442 C PS Sbjct: 218 HCKPS 222 >At4g25750.1 68417.m03707 ABC transporter family protein Bactrocera tryoni membrane transporter (white) gene, PID:g3676298 Length = 577 Score = 27.9 bits (59), Expect = 3.9 Identities = 20/66 (30%), Positives = 31/66 (46%) Frame = +2 Query: 254 TQPDPAVELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILDADIC 433 T P+ L L++ +IL + G G GKST+ I+ A SP +L++ + Sbjct: 23 TAEQPSFILRNITLTSHPSQILAIIGPSGAGKSTLLDILA---ARTSPTSGSILLNSVLI 79 Query: 434 GPSQPR 451 PS R Sbjct: 80 NPSSYR 85 >At1g61300.1 68414.m06909 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 762 Score = 27.9 bits (59), Expect = 3.9 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +2 Query: 248 RSTQP----DPAVELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMS 394 R TQP + +E RL + I+ L G GGVGK+T+ I + A MS Sbjct: 37 RPTQPTIGQEEMLEKAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMS 89 >At1g55620.2 68414.m06367 voltage-gated chloride channel family protein contains Pfam profiles PF00654: Voltage gated chloride channel, PF00571: CBS domain Length = 781 Score = 27.9 bits (59), Expect = 3.9 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 233 HLRIWRSTQPDPAVELIKQRLSNVKHKILILSGKGGV 343 H W T + A L QRL++ H+IL++ GGV Sbjct: 157 HEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGV 193 >At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 874 Score = 27.5 bits (58), Expect = 5.2 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 314 ILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGI 415 +L + G GGVGK+T+ S I + ++S D ++ I Sbjct: 177 LLGIYGMGGVGKTTLLSQINNKFRTVSNDFDIAI 210 >At1g66090.1 68414.m07501 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 429 Score = 27.5 bits (58), Expect = 5.2 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 305 KHKILILSGKGGVGKSTVTSIIGHGLASMS 394 K KI+ +SG G+GKST+ + H L S S Sbjct: 219 KVKIVGISGPAGIGKSTIARAL-HNLLSSS 247 >At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 897 Score = 27.5 bits (58), Expect = 5.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 293 LSNVKHKILILSGKGGVGKSTVTSIIGHGLASM 391 L N KI+ +SG G+GKST+ + + L++M Sbjct: 202 LKNDGVKIVGISGPAGIGKSTIATALHGRLSNM 234 >At4g20910.1 68417.m03031 double-stranded RNA binding protein-related / DsRBD protein-related contains weak similarity to Pfam profile PF00035: Double-stranded RNA binding motif Length = 942 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 362 MSQYFFRPPLYRTRSEFCALHWRDVVLSVLL 270 M FF+PPL + R E+ H R+ S L+ Sbjct: 688 MEAAFFKPPLSKQRVEYALKHIRESSASTLV 718 >At2g16790.1 68415.m01925 shikimate kinase family protein similar to thermosensitive glucokinase from Escherichia coli [SP|P39208] [SP|P46859]; contains Pfam profile PF01202: shikimate kinase Length = 189 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 296 SNVKHKILILSGKGGVGKSTVTSIIGHGLA 385 ++V K++ + G G GKST+ ++G L+ Sbjct: 5 NDVTGKVIAIMGVSGAGKSTIGKMLGKALS 34 >At1g75290.1 68414.m08746 isoflavone reductase, putative similar to SP|P52577 Isoflavone reductase homolog P3 (EC 1.3.1.-) {Arabidopsis thaliana}; contains Pfam profile PF02716: Isoflavone reductase Length = 323 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = +2 Query: 293 LSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILD 421 +++ K KIL++ G G +GK + + + G ++++ R + D Sbjct: 1 MASEKSKILVIGGTGHIGKLIIEASVKAGHSTLALVREASLSD 43 >At5g59500.1 68418.m07457 expressed protein Length = 396 Score = 26.6 bits (56), Expect = 9.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 489 PELWTCSPRTPSTRGWLGPQMSASS 415 P +W+C+P W+ P+ S SS Sbjct: 56 PSIWSCAPFPVRKGSWVPPRCSISS 80 >At5g43740.2 68418.m05348 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 862 Score = 26.6 bits (56), Expect = 9.1 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 263 DPAVELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGI 415 D VE+ L N + L L G GGVGK+T+ + + + + +V I Sbjct: 156 DKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVI 206 >At5g43740.1 68418.m05347 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 862 Score = 26.6 bits (56), Expect = 9.1 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 263 DPAVELIKQRLSNVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGI 415 D VE+ L N + L L G GGVGK+T+ + + + + +V I Sbjct: 156 DKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVI 206 >At5g17970.1 68418.m02108 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 780 Score = 26.6 bits (56), Expect = 9.1 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +2 Query: 311 KILILSGKGGVGKSTVTSIIGHGLASMSPD 400 K++ + G G+GK+T+T I+ + L+S + D Sbjct: 212 KMIGVWGPAGIGKTTITRILYNQLSSSNDD 241 >At1g64070.1 68414.m07258 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 997 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 293 LSNVKHKILILSGKGGVGKSTVTSIIGHGLAS 388 L N + K++ +SG G+GKST+ + H L S Sbjct: 203 LDNDEVKMVAISGPAGIGKSTIGRAL-HSLLS 233 >At1g03030.1 68414.m00275 phosphoribulokinase/uridine kinase family protein contains Pfam PF00485: Phosphoribulokinase / Uridine kinase family; Belongs to Interpro IPR006083 Phosphoribulokinase/uridine kinase family; similar to Uridine kinase (Uridine monophosphokinase) (SP:P27515) {Saccharomyces cerevisiae}; ESTs gb|AA585719, gb|AA728503 and gb|T22272 come from this gene Length = 301 Score = 26.6 bits (56), Expect = 9.1 Identities = 18/63 (28%), Positives = 33/63 (52%) Frame = +2 Query: 299 NVKHKILILSGKGGVGKSTVTSIIGHGLASMSPDRNVGILDADICGPSQPRVLGVRGEQV 478 N+K +++ L+G G GKSTV + + + + P + DA++ P VL + G + Sbjct: 93 NLK-RLVGLAGPPGAGKSTVANEVVRRVNKLWPQK-AASFDAEVNPPDVAIVLPMDGFHL 150 Query: 479 HNS 487 + S Sbjct: 151 YRS 153 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,051,820 Number of Sequences: 28952 Number of extensions: 229770 Number of successful extensions: 802 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -