BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00221 (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 3.5 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.2 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 676 FHDNAKTYYETDMITLNFEDAQNSV 750 F D + E D T+N + QN++ Sbjct: 517 FRDQKIMFIELDKFTVNLKQGQNTI 541 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/50 (24%), Positives = 20/50 (40%) Frame = +3 Query: 498 RLEIETADQSCVTATSKAYERHSKRIPKNLRMAPSQHEHNRTRQNQCHYC 647 ++E E D+ T E + K + S + +N+ N C YC Sbjct: 429 QVESEEEDEETSTTVFSNVEVVQEEAKKE--ESDSNNNNNKEEGNSCQYC 476 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,859 Number of Sequences: 336 Number of extensions: 3797 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -