BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00214X (331 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0721 - 20931241-20931669 29 0.67 01_05_0503 - 22779025-22779397,22779602-22779627 28 2.0 03_05_0819 + 27948797-27948956,27948976-27949202 27 2.7 02_02_0495 + 10954305-10954349,10954660-10955079 27 3.6 03_01_0334 - 2634192-2634460,2634571-2634760,2634857-2636071 27 4.7 02_05_1055 - 33798162-33798290,33798417-33798604,33798707-337987... 27 4.7 11_06_0701 + 26407055-26407597,26407794-26409644 26 6.2 11_02_0076 - 8059267-8059387,8059406-8059857 26 6.2 04_03_1022 - 21778315-21779007 26 6.2 01_06_0995 + 33661367-33661380,33661729-33661826,33662059-336622... 26 6.2 11_06_0207 + 21214631-21216121 26 8.3 02_05_1130 - 34319558-34319603,34320236-34320335,34320498-343205... 26 8.3 01_03_0221 - 13916129-13916504,13917183-13917217 26 8.3 >07_03_0721 - 20931241-20931669 Length = 142 Score = 29.5 bits (63), Expect = 0.67 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 229 RDWGASKKSRTGYESPG*AGPSEGPRWG 312 R GA + E+PG AG EGPRWG Sbjct: 114 RPAGARSRRERRLEAPG-AGEREGPRWG 140 >01_05_0503 - 22779025-22779397,22779602-22779627 Length = 132 Score = 27.9 bits (59), Expect = 2.0 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 174 LYKQKPFRLTFPTESKYRHHRTAYEIVLIRNTNVARLSN 58 LYK + ++L + E+K+R+ TA IR + LSN Sbjct: 42 LYKSQEYKLHYTLETKHRNRNTANSKDGIRMAAMENLSN 80 >03_05_0819 + 27948797-27948956,27948976-27949202 Length = 128 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 330 AHSGGGTPSRT--LARTSSPGALISGA 256 A GGG+PSRT LART++P A S + Sbjct: 18 AAGGGGSPSRTPRLARTAAPFASSSSS 44 >02_02_0495 + 10954305-10954349,10954660-10955079 Length = 154 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 262 RCATSLTLPNLVGMNGRLAQSAFIHTVTK 176 RC +L P+L GM G +A ++TVT+ Sbjct: 33 RCTINLAKPSLRGMQGGDKTTATVNTVTR 61 >03_01_0334 - 2634192-2634460,2634571-2634760,2634857-2636071 Length = 557 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 182 DCMDKSRLRQSTVHSNEIGERQRSRAPDMRAPGELVLARVR 304 DC+ + +R ++V S E RSR+ + A +L + +R Sbjct: 251 DCISEPIIRSNSVRSTSANENLRSRSVNSEADIQLAIKSLR 291 >02_05_1055 - 33798162-33798290,33798417-33798604,33798707-33798767, 33799045-33799122,33799250-33799472,33799599-33799824, 33799922-33800116,33800210-33800627,33800904-33801182 Length = 598 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 329 HTAAVAPHRGPSLGPAHPGLSYPVRDFFDAPQSRWNE 219 HTAA A GP+LG P P + F A ++E Sbjct: 69 HTAAAAAAAGPALGLTKPNAVEPPQVSFAAKDVEFSE 105 >11_06_0701 + 26407055-26407597,26407794-26409644 Length = 797 Score = 26.2 bits (55), Expect = 6.2 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 148 NISN*VQIQTPPHSVRDSLNTKYERCSF 65 N+ N ++ TPPH++RD + + C F Sbjct: 603 NVENIFEMLTPPHNLRDLVIGYFFGCRF 630 >11_02_0076 - 8059267-8059387,8059406-8059857 Length = 190 Score = 26.2 bits (55), Expect = 6.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 262 GYESPG*AGPSEGPRWGATAAVC 330 G SP G S PRW AT+ C Sbjct: 119 GARSPTRHGSSSSPRWRATSGYC 141 >04_03_1022 - 21778315-21779007 Length = 230 Score = 26.2 bits (55), Expect = 6.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 329 HTAAVAPHRGPSLGPAHPGLSYP 261 HT A AP GP + P HP +P Sbjct: 73 HTPAPAPAPGPYIPPHHPHHHHP 95 >01_06_0995 + 33661367-33661380,33661729-33661826,33662059-33662214, 33663307-33663926,33664020-33664090,33664176-33664427, 33664494-33664611,33664715-33664886,33664970-33665511 Length = 680 Score = 26.2 bits (55), Expect = 6.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 260 PDMRAPGELVLARVRDG 310 PD+ APG +LA V+DG Sbjct: 444 PDVAAPGSNILAAVKDG 460 >11_06_0207 + 21214631-21216121 Length = 496 Score = 25.8 bits (54), Expect = 8.3 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -2 Query: 210 WRSRLLSIQSLKLYKQKPFRLTFPTESKYRHHRTAYEIV 94 WRS S++ + YKQ+ L + TES Y +V Sbjct: 86 WRSAYTSLRDMGQYKQQTPCLLYTTESSGEKVSCLYSLV 124 >02_05_1130 - 34319558-34319603,34320236-34320335,34320498-34320577, 34320680-34320840,34321602-34321731,34322055-34322230, 34322873-34323068,34323768-34323889,34324376-34324468, 34324672-34324740,34325259-34325423,34325771-34326061 Length = 542 Score = 25.8 bits (54), Expect = 8.3 Identities = 16/66 (24%), Positives = 27/66 (40%) Frame = +2 Query: 119 CLYLDSVGNVKRKGFCLYSFSDCMDKSRLRQSTVHSNEIGERQRSRAPDMRAPGELVLAR 298 CL ++ ++KR G LYS + + + R P PG++V+ Sbjct: 380 CLDIEEPADIKRDGINLYSTVSVSYIEAILGTVKKVRTVDGNSELRIPPGTQPGDVVVL- 438 Query: 299 VRDGVP 316 + GVP Sbjct: 439 AKQGVP 444 >01_03_0221 - 13916129-13916504,13917183-13917217 Length = 136 Score = 25.8 bits (54), Expect = 8.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 190 G*KPTAPVYRSFQRDWGASKKSRTGYESPG*AGPSEG 300 G + T+PV + DW A+ R G S G G +G Sbjct: 83 GHRSTSPVRTPRRSDWAAATARRGGAASGGVCGEEKG 119 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,140,168 Number of Sequences: 37544 Number of extensions: 190995 Number of successful extensions: 491 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 447336660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -