BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00214X (331 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35230.2 68415.m04322 VQ motif-containing protein contains PF... 33 0.046 At2g35230.1 68415.m04321 VQ motif-containing protein contains PF... 33 0.046 >At2g35230.2 68415.m04322 VQ motif-containing protein contains PF05678: VQ motif Length = 295 Score = 33.1 bits (72), Expect = 0.046 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -3 Query: 311 PHRGPSLGPAHPGLSYPV--RDFFDAPQSRWNE 219 P +GP P PGL +P+ FF P RWN+ Sbjct: 262 PSQGPPQPPPSPGLMFPLSPSGFFPMPSPRWND 294 >At2g35230.1 68415.m04321 VQ motif-containing protein contains PF05678: VQ motif Length = 402 Score = 33.1 bits (72), Expect = 0.046 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -3 Query: 311 PHRGPSLGPAHPGLSYPV--RDFFDAPQSRWNE 219 P +GP P PGL +P+ FF P RWN+ Sbjct: 369 PSQGPPQPPPSPGLMFPLSPSGFFPMPSPRWND 401 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,863,068 Number of Sequences: 28952 Number of extensions: 148249 Number of successful extensions: 374 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 374 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 380568784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -