BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00211 (832 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 26 1.2 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 26 1.2 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 24 6.5 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 26.2 bits (55), Expect = 1.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 580 KVKA*VMDLLCIFYLVCGTIIATVCMVL 663 K A V+D C+F TIIATV ++L Sbjct: 455 KFAAMVVDRFCLFVFTLFTIIATVTVLL 482 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 26.2 bits (55), Expect = 1.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 580 KVKA*VMDLLCIFYLVCGTIIATVCMVL 663 K A V+D C+F TIIATV ++L Sbjct: 455 KFAAMVVDRFCLFVFTLFTIIATVTVLL 482 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.8 bits (49), Expect = 6.5 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 691 VIDCQYRISLEPYILLQLLFRKPGRKCTISPL 596 + D YR+ EP +L F+ P K + L Sbjct: 241 IFDLMYRLEFEPEYVLWKYFQTPSLKLLMQEL 272 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 738,507 Number of Sequences: 2352 Number of extensions: 14411 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -