BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00209 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 27 0.81 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 24 4.3 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 7.6 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 7.6 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 23 7.6 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 26.6 bits (56), Expect = 0.81 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 244 QGGCHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 375 QGG Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 121 QGG-GQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = +1 Query: 130 AGCSQAPPVRVQGAHPSGPGQ*CSRFYVQELEAALLREQGGCHQTSAE 273 +G + PP+ G P+GP FY A L G + AE Sbjct: 317 SGITGVPPIPADGPSPAGPYTNVPGFYSFGEVCAKLPNPGNANLKGAE 364 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 7.6 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -1 Query: 355 RRHPDRTYEYHHHGH 311 ++HP + +HHH H Sbjct: 175 QQHPGHSQHHHHHHH 189 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 7.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -1 Query: 325 HHHGHAEFGRQHVQYPMIQHWFGDSLLAHA 236 HH H G+ H Q+ G SL++ A Sbjct: 649 HHQAHQHQGQHHAQHHSNGTHHGPSLMSSA 678 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 23.4 bits (48), Expect = 7.6 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = -1 Query: 346 PDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDSLLAHAVGLPRVLGHRNVNIIDQVRTDGR 167 PD+T Y +G E +HV+ + + D+ A V L V+G + ++ GR Sbjct: 48 PDKTAAYVAYGGQETLVEHVEVLVHKQLIWDTASAGQVPLGAVVGGHTSD--GEILYVGR 105 Query: 166 LEHE 155 HE Sbjct: 106 AYHE 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,099 Number of Sequences: 2352 Number of extensions: 15631 Number of successful extensions: 48 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -