BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00207 (720 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity fac... 27 2.7 SPBC1604.17c |||conserved fungal protein|Schizosaccharomyces pom... 26 4.7 SPBC2D10.05 |exg3||glucan 1,3-beta-glucosidase Exg3|Schizosaccha... 26 6.2 SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe... 26 6.2 >SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity factor complex subunit, Fip1 homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 344 Score = 27.1 bits (57), Expect = 2.7 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 336 HSSVVPRDSSRF-SPERGSGVSPTGQGARPRRRQ 434 HSS P S R SP+R S S G G R RR + Sbjct: 310 HSSNYPSSSRRKPSPDRYSNYSSRGSGGRYRRNR 343 >SPBC1604.17c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 459 Score = 26.2 bits (55), Expect = 4.7 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -1 Query: 459 LPPTSGEAPDAGGGALPGRWETRHSHVRG*IYWSLEEQQSYVVE 328 LPP + D L +W+T++ + I+W +++Q S +E Sbjct: 181 LPPDKFHS-DQSKALLEPKWKTKNYLISHLIFWIIDQQSSSSIE 223 >SPBC2D10.05 |exg3||glucan 1,3-beta-glucosidase Exg3|Schizosaccharomyces pombe|chr 2|||Manual Length = 464 Score = 25.8 bits (54), Expect = 6.2 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 1/76 (1%) Frame = +1 Query: 238 GHAEHEEIYPYQDRTVKEIVIHKDFNKGNLFYDIALLFLETPVDSAPNVGVACLPPARER 417 G AE E YQDRTV E V G I + + P+ +V AR Sbjct: 155 GKAEFYEKQEYQDRTV-EAVKFLSSKIGQFENVIGIQVINEPIWGQYDVLANFYQKARSV 213 Query: 418 APAGVRCF-ATGWGKD 462 P+ + + GW KD Sbjct: 214 VPSYLPVYIGDGWDKD 229 >SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 830 Score = 25.8 bits (54), Expect = 6.2 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -2 Query: 470 PNLSF-PQPVAKHLTPAGARSLAGGRHATPTFGAESTGVS 354 P +SF P +++LTP ++SLA +F + S S Sbjct: 189 PTVSFSPASTSENLTPTSSKSLASNTSLVQSFNSASRSSS 228 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,942,486 Number of Sequences: 5004 Number of extensions: 61937 Number of successful extensions: 170 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -