BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00206 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 4.2 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 9.7 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -1 Query: 481 RRLVQIDLPGNVSEESLAYGVVREPVRKVHGHSWCPLYCTIYGGY 347 RR+ +D G S+ Y EP++ V SW Y + Y Sbjct: 994 RRVPLMDYQGICSDRDNPYTGAGEPLKPVRPMSWLLQYFVSFATY 1038 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.0 bits (47), Expect = 9.7 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 587 RRSLPHRIRSVQDNQTAEERDGVPARQTAKIRSGHQLCVRDPSRRL 724 ++S P S + TA ++Q+A I SGH L +PS L Sbjct: 62 KQSSPPARLSSSASSTAAALLKTKSKQSALIGSGHYLARDEPSTSL 107 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,711 Number of Sequences: 2352 Number of extensions: 16941 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -