BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00206 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 27 0.18 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 27 0.18 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 27 0.18 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.0 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 3.9 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 5.2 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 21 9.0 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 21 9.0 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 27.1 bits (57), Expect = 0.18 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 361 WYNRVDTRSDHELYVPVRGRPHRRDSLRKHYLEDRSEP 474 ++N +DT+ ++L PV G R + HY D+S+P Sbjct: 115 YFNLIDTKC-YKLEHPVTGCGERTEGRCLHYTVDKSKP 151 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 27.1 bits (57), Expect = 0.18 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 361 WYNRVDTRSDHELYVPVRGRPHRRDSLRKHYLEDRSEP 474 ++N +DT+ ++L PV G R + HY D+S+P Sbjct: 120 YFNLIDTKC-YKLEHPVTGCGERTEGRCLHYTVDKSKP 156 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 27.1 bits (57), Expect = 0.18 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 361 WYNRVDTRSDHELYVPVRGRPHRRDSLRKHYLEDRSEP 474 ++N +DT+ ++L PV G R + HY D+S+P Sbjct: 120 YFNLIDTKC-YKLEHPVTGCGERTEGRCLHYTVDKSKP 156 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 698 IVDVHFESWQFVSQVRHHVLLQFGCP 621 IVD H S F+ + + L+ GCP Sbjct: 359 IVDHHTASESFMKHYENEMRLRNGCP 384 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 389 TMNFTYRFADDPIGETLFGN 448 T+NFTY A P G+ FGN Sbjct: 473 TINFTYSLALSPDGQ--FGN 490 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 563 CCTARTDGRRSLPHRIRSVQDNQTAEE 643 CC R GRRS R + +N ++++ Sbjct: 344 CCKTRIIGRRSWVTRESQICNNSSSDK 370 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 546 IFCVYHVRIVNAVYVLSACVQCAGWFRSIFQVMF 445 + CV + +V+A V C Q AG+ S + M+ Sbjct: 8 LLCVIYCALVHADTVAILCSQKAGFDLSDLKSMY 41 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 546 IFCVYHVRIVNAVYVLSACVQCAGWFRSIFQVMF 445 + CV + +V+A V C Q AG+ S + M+ Sbjct: 8 LLCVIYCALVHADTVAILCSQKAGFDLSDLKSMY 41 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,453 Number of Sequences: 438 Number of extensions: 4735 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -