BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00204 (828 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_15879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1325 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 702 FDSYEFVFQQFGNFAHR*TVKPLPLQATFLLSRKNVFNFD 583 FD + GNF+HR TVK LP ++S++ + F+ Sbjct: 1147 FDKFNNFVSGIGNFSHRYTVKHLPDTEENMMSQRVLGPFE 1186 >SB_15879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +1 Query: 610 EKKSSLQ--RQRFNSLPVSEVPELLKNEFIAVENARQVHICTD 732 EK+SS Q +Q + V + PELL + + +E ++ + C+D Sbjct: 14 EKQSSRQFNQQDLQDMQVKDEPELLDFQSVVIEASKLLETCSD 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,168,974 Number of Sequences: 59808 Number of extensions: 409114 Number of successful extensions: 1217 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1217 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -