BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00203 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 22 4.6 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 6.1 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 8.1 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 114 GLIDILSSCAVCLNAFQ*MLA 52 GLID + C V LN +Q LA Sbjct: 15 GLIDWYTVCLVPLNPYQFFLA 35 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 69 KRSNKPHRN*ECQLSLKHLREAPTADTFGNLVSRR 173 K SN+PH+ + H+ + D +G L + R Sbjct: 179 KSSNRPHQGPLTPILYDHIGDLVCVDFYGPLPTGR 213 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 480 LSPAGVIAKSPHRSPFPTVAHLNGEWQIVSV 572 LSP+G SP+P L+G + S+ Sbjct: 58 LSPSGNTPNKSSTSPYPPNHPLSGSKHLCSI 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,493 Number of Sequences: 336 Number of extensions: 3724 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -