BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00203 (762 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 4.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.1 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 9.4 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 9.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 9.4 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 312 SSKELDISYSSYDALVHRYS 253 S+ D+S Y++LVH Y+ Sbjct: 239 SANRTDLSKDDYESLVHLYT 258 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = -1 Query: 225 SLCSCSAGVVLCIGEKPSAGIPSSRRYRLSVPP 127 +L + +G C+ P+A + + + ++ VPP Sbjct: 678 NLAAEHSGDYTCVAANPAAEVRYTAKLQVKVPP 710 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 2 YEFEQKDPYTTPTQLDDA 55 Y+ +DP TP Q DD+ Sbjct: 408 YQTMSRDPARTPFQWDDS 425 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 736 ESTFFNSGLLFQTGTTLNPI 677 E + SG L+ TT+NPI Sbjct: 307 EWLYILSGCLYYFSTTINPI 326 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 2 YEFEQKDPYTTPTQLDDA 55 Y+ +DP TP Q DD+ Sbjct: 408 YQTMSRDPARTPFQWDDS 425 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,706 Number of Sequences: 438 Number of extensions: 4514 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -