BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00202 (791 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0637 - 19153136-19153513,19153607-19153759,19153857-191546... 28 7.4 08_02_0501 + 17836948-17837373,17837857-17839184,17839270-178393... 28 9.8 03_06_0224 - 32483363-32483671,32483765-32483929,32484957-32485301 28 9.8 >09_04_0637 - 19153136-19153513,19153607-19153759,19153857-19154675, 19155068-19155174,19155434-19155548 Length = 523 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 754 NYKTVIVNSSCKLVFLLLSEKKKVFIKNMMTVLIFWTF 641 N +T+ V S C++V + K +++K++ L WTF Sbjct: 336 NVETLAVASHCEMVDTPMLPTKLLYLKHLTISLFAWTF 373 >08_02_0501 + 17836948-17837373,17837857-17839184,17839270-17839380, 17839719-17839998,17840275-17840396,17840451-17840556, 17840814-17841020,17841130-17841255,17841719-17841817, 17842265-17842456,17842555-17843073 Length = 1171 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 564 NFWLTFHFH--KFPTSVLQAHSRDSKLSNVQNINTVIIF 674 +F T H++ ++P S Q RDSKL N I ++IF Sbjct: 247 SFLGTLHYNGQQYPLSPQQILLRDSKLRNTNQIYGIVIF 285 >03_06_0224 - 32483363-32483671,32483765-32483929,32484957-32485301 Length = 272 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 510 WAALKPPCFVAR*RHSGTNFWLTFHFHK 593 +AA PP FV+ ++ T+F L F F+K Sbjct: 149 YAARSPPVFVSNSSYTVTSFTLVFEFNK 176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,749,013 Number of Sequences: 37544 Number of extensions: 308928 Number of successful extensions: 532 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -