BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00202 (791 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_11293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 >SB_24987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 684 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -1 Query: 737 CKFIM*IGIFTFIRKKKSFYQEYDDSVDIL 648 CK I+ + IFTF+ SFY+ Y +S D+L Sbjct: 13 CKAIIFLTIFTFLILGVSFYRYYHNSKDLL 42 >SB_11293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 645 VQNINTVIIFLIKTFFFSDKSKNTNLHDEFTMTVL*LLLPNNSW 776 V ++T + ++K FF++DK D F + L + +N+W Sbjct: 49 VTTVSTAFV-VVKVFFYNDKEFQRKAKDTFDTALQLLTMEDNTW 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,504,948 Number of Sequences: 59808 Number of extensions: 390296 Number of successful extensions: 819 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -