BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00202 (791 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 26 1.2 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 26 1.5 AY344822-1|AAR02433.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344821-1|AAR02432.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344820-1|AAR02431.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344819-1|AAR02430.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344818-1|AAR02429.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344817-1|AAR02428.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344816-1|AAR02427.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344815-1|AAR02426.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 8.2 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 8.2 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 26.2 bits (55), Expect = 1.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 43 RRSLDKFKICVRCGSAVH 96 R S D+ ++C+RCGS H Sbjct: 491 RSSTDRQQLCIRCGSEGH 508 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 43 RRSLDKFKICVRCGSAVHL 99 R +D+ K C+RCG+ HL Sbjct: 378 RSPVDRQKACIRCGAEGHL 396 >AY344822-1|AAR02433.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 687 FFFSDKSKNTNLHDEFTM 740 F FS S N NLH FT+ Sbjct: 89 FLFSSNSDNQNLHTTFTV 106 >AY344821-1|AAR02432.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 687 FFFSDKSKNTNLHDEFTM 740 F FS S N NLH FT+ Sbjct: 89 FLFSSNSDNQNLHTTFTV 106 >AY344820-1|AAR02431.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 687 FFFSDKSKNTNLHDEFTM 740 F FS S N NLH FT+ Sbjct: 89 FLFSSNSDNQNLHTTFTV 106 >AY344819-1|AAR02430.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 687 FFFSDKSKNTNLHDEFTM 740 F FS S N NLH FT+ Sbjct: 89 FLFSSNSDNQNLHTTFTV 106 >AY344818-1|AAR02429.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 687 FFFSDKSKNTNLHDEFTM 740 F FS S N NLH FT+ Sbjct: 89 FLFSSNSDNQNLHTTFTV 106 >AY344817-1|AAR02428.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 687 FFFSDKSKNTNLHDEFTM 740 F FS S N NLH FT+ Sbjct: 89 FLFSSNSDNQNLHTTFTV 106 >AY344816-1|AAR02427.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 687 FFFSDKSKNTNLHDEFTM 740 F FS S N NLH FT+ Sbjct: 89 FLFSSNSDNQNLHTTFTV 106 >AY344815-1|AAR02426.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 687 FFFSDKSKNTNLHDEFTM 740 F FS S N NLH FT+ Sbjct: 89 FLFSSNSDNQNLHTTFTV 106 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.4 bits (48), Expect = 8.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 43 RRSLDKFKICVRCGSAVH 96 R +D+ +C+RCG H Sbjct: 565 RSPVDRQNVCIRCGQEGH 582 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 8.2 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = +1 Query: 55 DKFKICVRCGSAVHLP*GALR*CVTDFRVSKTIKIDCNSLRRTRTQNTITF 207 ++FK CV+C P C T+ + I ++ ++ R N TF Sbjct: 682 NEFKHCVQCQQYKTGPLAEANECATNCTLFVPIPVEKVTIDEERNDNKCTF 732 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,055 Number of Sequences: 2352 Number of extensions: 13836 Number of successful extensions: 29 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -