BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00195 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 74 4e-15 EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. 23 9.4 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.4 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.4 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 74.1 bits (174), Expect = 4e-15 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +3 Query: 102 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVV 254 +KDS+D +L AGD+LVV+DF ATWCGPCK+I PKL+E + +D IVV Sbjct: 5 VKDSEDFNNKLEAAGDQLVVVDFFATWCGPCKVIAPKLEEFQNKYADKIVV 55 Score = 60.1 bits (139), Expect = 7e-11 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 376 KVDVDECE++A++YNI SMPTF+F+K + + +FSGAN + Sbjct: 57 KVDVDECEELAAQYNIASMPTFLFIKRKEVVGQFSGANAE 96 >EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 9.4 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 571 FFAFQRLQTLKINIFKFITDVKTFFLHLLKTYTCFFFFNSI 449 FF RLQTL ++ T T F L + T NS+ Sbjct: 37 FFGASRLQTLDLSDNAIATIESTAFKRLRELKTLLLXSNSL 77 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 420 LVSIYLCLRIVVLSLSTLAPE 358 LVSI +C+ +VVL++ +P+ Sbjct: 316 LVSISICVTVVVLNVHFRSPQ 336 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 420 LVSIYLCLRIVVLSLSTLAPE 358 LVSI +C+ +VVL++ +P+ Sbjct: 316 LVSISICVTVVVLNVHFRSPQ 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,926 Number of Sequences: 2352 Number of extensions: 12572 Number of successful extensions: 43 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -