BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00195 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.6 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.8 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.8 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.8 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.8 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -2 Query: 179 GRHEVDHDELVSGF 138 G H+VD DEL++G+ Sbjct: 122 GDHDVDKDELITGW 135 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.0 bits (47), Expect = 2.8 Identities = 17/64 (26%), Positives = 25/64 (39%) Frame = -3 Query: 631 KLLTNI*FYLLNCLITTGPIFFAFQRLQTLKINIFKFITDVKTFFLHLLKTYTCFFFFNS 452 K NI +YLL T + + ++N F + F+ L Y F NS Sbjct: 190 KTYNNIDYYLLAANYTGW--YLTKHNVPEQRLNYFTEDVGLNHFYFMLNHNYPPFMLSNS 247 Query: 451 I*FP 440 + FP Sbjct: 248 LNFP 251 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 420 LVSIYLCLRIVVLSLSTLAPE 358 LVSI +C+ +VVL++ +P+ Sbjct: 317 LVSISICVTVVVLNVHFRSPQ 337 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 420 LVSIYLCLRIVVLSLSTLAPE 358 LVSI +C+ +VVL++ +P+ Sbjct: 317 LVSISICVTVVVLNVHFRSPQ 337 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.0 bits (47), Expect = 2.8 Identities = 17/64 (26%), Positives = 25/64 (39%) Frame = -3 Query: 631 KLLTNI*FYLLNCLITTGPIFFAFQRLQTLKINIFKFITDVKTFFLHLLKTYTCFFFFNS 452 K NI +YLL T + + ++N F + F+ L Y F NS Sbjct: 190 KTYNNIDYYLLAANYTGW--YLTKHNVPEQRLNYFTEDVGLNHFYFMLNHNYPPFMLSNS 247 Query: 451 I*FP 440 + FP Sbjct: 248 LNFP 251 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,426 Number of Sequences: 438 Number of extensions: 3397 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -