BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00195 (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 55 4e-08 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 53 2e-07 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 52 3e-07 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 51 7e-07 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 50 2e-06 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 50 2e-06 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 49 3e-06 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 49 3e-06 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 49 3e-06 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 49 3e-06 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 48 5e-06 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 48 8e-06 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 47 1e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 47 1e-05 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 46 2e-05 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 46 2e-05 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 45 4e-05 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 45 4e-05 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 45 4e-05 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 45 6e-05 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 43 2e-04 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 43 2e-04 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 43 2e-04 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 43 2e-04 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 42 4e-04 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 42 4e-04 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 42 5e-04 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 41 0.001 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 40 0.002 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 40 0.002 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 39 0.003 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 38 0.005 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 38 0.006 At5g61340.1 68418.m07697 expressed protein 38 0.009 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 38 0.009 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 37 0.015 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 37 0.015 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 36 0.020 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 36 0.026 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 36 0.026 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 36 0.026 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 36 0.035 At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase f... 34 0.080 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 34 0.080 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 34 0.080 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 34 0.11 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 34 0.11 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 34 0.11 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 33 0.14 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 33 0.18 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 33 0.24 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 33 0.24 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 31 0.98 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 31 0.98 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 31 0.98 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 31 0.98 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 29 2.3 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 29 2.3 At5g17890.1 68418.m02098 LIM domain-containing protein / disease... 29 4.0 At4g31240.2 68417.m04435 expressed protein 28 6.9 At4g31240.1 68417.m04434 expressed protein 28 6.9 At1g78740.1 68414.m09177 hypothetical protein 28 6.9 At5g36010.1 68418.m04337 hypothetical protein contains Pfam prof... 27 9.2 At4g02330.1 68417.m00317 pectinesterase family protein contains ... 27 9.2 At2g45060.1 68415.m05609 expressed protein 27 9.2 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 27 9.2 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 27 9.2 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 27 9.2 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 27 9.2 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/51 (49%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = +3 Query: 96 IHIKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 242 + IK+ + K+RL D KL+VI+F A WCGPCK + PKL+E+AA+ +D Sbjct: 40 VEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTD 90 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 376 K+DVD + E+N++++P VF+K G+++D G VD Sbjct: 95 KIDVDVLMSVWMEFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 370 FKVDVDE + +A E+ + +MPTFVF+K G+ +D+ GAN Sbjct: 64 FKVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/51 (37%), Positives = 31/51 (60%) Frame = +3 Query: 99 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIV 251 H D ++ A+ +KL+VIDF A+WC PC+MI P +++A + S + Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAI 62 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 376 K+DVDE D+A E+N+ +MPTFV VK GK+++ GA D Sbjct: 83 KLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKD 122 Score = 45.2 bits (102), Expect = 4e-05 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +3 Query: 147 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 242 +KL+V+DF A+WCGPC+MI P + +A + +D Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAMADKFND 78 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 51.2 bits (117), Expect = 7e-07 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +3 Query: 108 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 D D + AGDK+VV+D WCGPCK+I PK E++ + D + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMV 130 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +3 Query: 84 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 233 P M I I ++ L +AGD+LV++DF TWCG C+ + PKL + A E Sbjct: 93 PNM-IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE 141 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 50.0 bits (114), Expect = 2e-06 Identities = 18/38 (47%), Positives = 32/38 (84%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 370 KVD+D+ D+A+ +NI+S+PTF F+++GK++D+ GA+ Sbjct: 328 KVDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGAD 365 Score = 47.2 bits (107), Expect = 1e-05 Identities = 18/50 (36%), Positives = 30/50 (60%) Frame = +3 Query: 90 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMS 239 +SIH + KT+ A+ +L+++ F ATWCGPC+ + P +A + S Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS 322 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/37 (48%), Positives = 29/37 (78%) Frame = +3 Query: 138 EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 + +KL+VIDF A WCGPCK + P++ EIA++ S+++ Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSEAV 76 Score = 42.7 bits (96), Expect = 2e-04 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 376 +VDVD D+A Y ++P FVFVK G+++D GA D Sbjct: 79 RVDVDRLMDVAGTYRAITLPAFVFVKRGEEIDRVVGAKPD 118 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 376 FK+DVDE + +A E+ + +MPTFVF+K G +D GA D Sbjct: 62 FKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKD 102 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 123 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 K + A KL+VIDF A+WC PC+ I P E+A + ++ + Sbjct: 19 KVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVV 60 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +3 Query: 132 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVV 254 L + DK V++DF ATWCGPC+++ P L+E++ + D I V Sbjct: 71 LLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAV 111 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 K+D ++ +A++Y I ++PTF+ K+GK D F GA Sbjct: 113 KIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGA 149 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/39 (48%), Positives = 30/39 (76%) Frame = +2 Query: 260 VDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 376 VDVDE +++AS+ + +MPTF+F+K+G +D+ GAN D Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPD 99 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 376 KVD DE + +AS++ I +MPTF+F+K GK LD+ GA D Sbjct: 64 KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKD 103 Score = 41.9 bits (94), Expect = 4e-04 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +3 Query: 90 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEM 236 ++ H ++ + + + A LVV+DF A+WCGPC+ I P ++A ++ Sbjct: 9 IACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL 57 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 47.6 bits (108), Expect = 8e-06 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = +3 Query: 108 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 D D + AG+KLVV+D WCGPCK+I PK ++ + D + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVV 120 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 46.8 bits (106), Expect = 1e-05 Identities = 19/55 (34%), Positives = 34/55 (61%) Frame = +3 Query: 84 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E D + Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIV 156 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 46.8 bits (106), Expect = 1e-05 Identities = 19/55 (34%), Positives = 34/55 (61%) Frame = +3 Query: 84 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E D + Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIV 156 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = +3 Query: 96 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMS 239 I K+S D K A+ K+VV +F ATWCGPCK++ P E++ + S Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHS 75 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +2 Query: 260 VDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 370 VDVDE D +S ++I + PTF F+KNG+++ + GAN Sbjct: 82 VDVDELSDFSSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 46.0 bits (104), Expect = 2e-05 Identities = 17/36 (47%), Positives = 26/36 (72%) Frame = +3 Query: 147 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVV 254 DK V++D+ ATWCGPC+ + P L+E++ + D I V Sbjct: 81 DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQV 116 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 K+D ++ IA++Y I ++PTF+ K+G+ D F GA Sbjct: 118 KIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGA 154 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 45.2 bits (102), Expect = 4e-05 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = +3 Query: 102 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 227 + DL L AGDKLVV+DF + CG CK + PK+ +IA Sbjct: 98 VTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKIA 139 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 45.2 bits (102), Expect = 4e-05 Identities = 14/33 (42%), Positives = 25/33 (75%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVV 254 V+++F+ATWCGPCK+I P ++ ++ E D + + Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTI 122 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +3 Query: 102 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 I + +L L AGDKLVV+DF + CG CK + PK+ + AEM+ + Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQF-AEMNPDV 149 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 123 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 K + A KL+VIDF ATWC PC+ I P ++A + D + Sbjct: 19 KLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVV 60 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 FKVDVDE +A E+ + +MPTF+F+K G+ + GA Sbjct: 62 FKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGA 99 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +3 Query: 96 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 227 + I+ ++ L L AGD+LVV+DF + CG CK + PK+ ++A Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 VV+DF A WCGPCKMI P ++++A + I Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKI 131 Score = 31.5 bits (68), Expect = 0.56 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 +K++ DE + +Y + S+PT + G+K D GA Sbjct: 134 YKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKDTIIGA 171 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = +3 Query: 111 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 227 +D L D+ V +DF A WCGPCKMI P ++E+A Sbjct: 80 NDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELA 118 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 +K++ DE +Y + S+PT + NG+K D GA Sbjct: 128 YKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGA 165 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 42.7 bits (96), Expect = 2e-04 Identities = 18/47 (38%), Positives = 34/47 (72%) Frame = +3 Query: 99 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMS 239 ++ DS+ +T++ E+ D V+++F A WCGPC+MI P +D++A + + Sbjct: 90 NLSDSE-WQTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQLAKDFA 134 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 +K++ DE + A+ Y I S+PT + K G+K D GA Sbjct: 140 YKINTDESPNTANRYGIRSVPTVIIFKGGEKKDSIIGA 177 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +3 Query: 111 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE-MSDSIVV 254 SD L + +G K V+++F A WCG C+ + P LDE+A SDS VV Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVV 428 Score = 37.5 bits (83), Expect = 0.009 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 +V++F A WCG CK + P+ ++ A+ +S ++ Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNV 80 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +3 Query: 111 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE-MSDSIVV 254 SD L + +G K V+++F A WCG C+ + P LDE+A SDS VV Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVV 428 Score = 37.5 bits (83), Expect = 0.009 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 +V++F A WCG CK + P+ ++ A+ +S ++ Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNV 80 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 41.5 bits (93), Expect = 5e-04 Identities = 15/36 (41%), Positives = 28/36 (77%) Frame = +2 Query: 260 VDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 VDV+E + ++E+N+ + PT VF+K+G+++D+ GA Sbjct: 45 VDVEELAEFSNEWNVEATPTVVFLKDGRQMDKLVGA 80 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 174 ATWCGPCKMIGPKLDEIAAEMSDSIVVS 257 A WC PCK I P ++A+ I V+ Sbjct: 17 APWCVPCKKIEPVFRDLASRYPSMIFVT 44 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = +3 Query: 144 GDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMSDSIVV 254 GD+ V ++DF ATWCGPC ++ +L+ +A E + ++ Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAII 129 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/73 (28%), Positives = 42/73 (57%), Gaps = 9/73 (12%) Frame = +3 Query: 69 VSIYLPKMSIHIKDSDDLKTRLAEAGD-------KLVVIDFMATWCGPCKMIGPKLDEIA 227 V+++ I ++++ +K +AE+ D K V+I+F A WCG C+ + P LDE+A Sbjct: 357 VAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 Query: 228 AEMSD--SIVVSR 260 + S+++++ Sbjct: 417 LSFQNDPSVIIAK 429 Score = 36.3 bits (80), Expect = 0.020 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAEMS 239 +V++F A WCG C+ + P+ ++ A+E+S Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELS 76 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +2 Query: 257 KVDVDE--CEDIASEYNINSMPTFVFVKN-GKKLDEFSG 364 K+D E ++ A+EY I PT ++N GK + +++G Sbjct: 86 KIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNG 124 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 39.5 bits (88), Expect = 0.002 Identities = 13/37 (35%), Positives = 28/37 (75%) Frame = +2 Query: 260 VDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 370 +DV+E + + E+N+++ PT VF+K+G+++D+ G + Sbjct: 99 IDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGD 135 Score = 35.5 bits (78), Expect = 0.035 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = +3 Query: 78 YLPKMSIH-IKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 Y K +H + + + ++ EA K++V++F A+WC P K I P E+A+ + I Sbjct: 36 YFIKGKVHPVSRMEKWEEKITEANSHGKILVVNFKASWCLPSKTILPIYQELASTYTSMI 95 Query: 249 VVS 257 V+ Sbjct: 96 FVT 98 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/39 (38%), Positives = 27/39 (69%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 370 F+V+ +E +I+ Y++ ++P FVF K+GK +D GA+ Sbjct: 56 FRVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEGAD 94 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 38.3 bits (85), Expect = 0.005 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 V+++F +WCGPC+M+ +DEIA + + + Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKL 117 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 364 + ++ D +A EY I ++P + KNG+K + G Sbjct: 120 YLLNADNDLPVAEEYEIKAVPVVLLFKNGEKRESIMG 156 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 370 F+V+ +E +I+ Y++ +P FVF K+GK +D GA+ Sbjct: 56 FRVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEGAD 94 >At5g61340.1 68418.m07697 expressed protein Length = 326 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/56 (41%), Positives = 31/56 (55%) Frame = -3 Query: 502 FFLHLLKTYTCFFFFNSI*FPSAAAYNFSLYLLVFKDSCFEFVDVSAREFVQFLAI 335 F+L LLKTY C FFF SA A F+L+ L + + E S+R F FL++ Sbjct: 122 FYLRLLKTYVCNFFF----LLSANASAFALFFLAY--NTLEAFGFSSRNFYTFLSL 171 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLD---EIAAEMSDSIVVSR 260 + +DF A WCG CK + P+LD I A++ IV+++ Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAK 89 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 36.7 bits (81), Expect = 0.015 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 39 FAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLD 218 F F + L LVS + + DS + + DK +++F A WCG CK + P+ + Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEV----GKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 219 EIAA--EMSDSIVVSR 260 ++ A + + S+++++ Sbjct: 64 KLGASFKKAKSVLIAK 79 Score = 34.3 bits (75), Expect = 0.080 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +3 Query: 147 DKLVVIDFMATWCGPCKMIGPKLDEIAA--EMSDSIVVS 257 +K V+++F A WCG CK + P +++A + + +V++ Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIA 197 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 36.7 bits (81), Expect = 0.015 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 39 FAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLD 218 F F + L LVS + + DS + + DK +++F A WCG CK + P+ + Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEV----GKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 219 EIAA--EMSDSIVVSR 260 ++ A + + S+++++ Sbjct: 64 KLGASFKKAKSVLIAK 79 Score = 34.3 bits (75), Expect = 0.080 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +3 Query: 147 DKLVVIDFMATWCGPCKMIGPKLDEIAA--EMSDSIVVS 257 +K V+++F A WCG CK + P +++A + + +V++ Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIA 197 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 36.3 bits (80), Expect = 0.020 Identities = 12/29 (41%), Positives = 23/29 (79%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAEMSD 242 ++I++MA+WC C + PKL+++AAE ++ Sbjct: 121 IIIEWMASWCRKCIYLKPKLEKLAAEYNN 149 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 35.9 bits (79), Expect = 0.026 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +3 Query: 102 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMSD 242 +K ++ +++A D + V F A WCGPC+ I P + E++ + D Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPD 137 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 35.9 bits (79), Expect = 0.026 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +3 Query: 144 GDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVVSR 260 G KL+V+D CGPC + P + +++ MS+++V +R Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFAR 244 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +2 Query: 269 DECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 D C + + N+ +PTF+F+++G+ + G+ Sbjct: 251 DSCMEFLKDMNVIEVPTFLFIRDGEIRGRYVGS 283 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +3 Query: 102 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMSD 242 +K + + L++A D + V F A WCGPC++I P + E++ + D Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPD 102 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 35.5 bits (78), Expect = 0.035 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 150 KLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 K + + F A WCGPC+ P+L E+ E+S + Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNELSSKV 76 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 99 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 242 ++ D K +++ K +++ F A WC PC+ PKL E+ ++ + Sbjct: 347 YVLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEVYKQIKE 394 >At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase family protein contains Pfam PF01553: Acyltransferase Length = 376 Score = 34.3 bits (75), Expect = 0.080 Identities = 18/63 (28%), Positives = 35/63 (55%) Frame = +3 Query: 24 LECFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMI 203 L CF AF +I +S+++P ++ +K D L+ ++ +++ F+A+W G K Sbjct: 99 LRCFTLAFGWIIF--LSLFIPVNAL-LKGQDRLRKKIERVLVEMICSFFVASWTGVVKYH 155 Query: 204 GPK 212 GP+ Sbjct: 156 GPR 158 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 34.3 bits (75), Expect = 0.080 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAE 233 VVI +MA WC C + PKL+++AAE Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAE 126 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 34.3 bits (75), Expect = 0.080 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDE 355 KVD+D+C I + N+ +PT KNG ++ E Sbjct: 649 KVDIDKCPSIGNAENVRVVPTVKIYKNGSRVKE 681 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 33.9 bits (74), Expect = 0.11 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +3 Query: 147 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVV 254 ++ V+++F A WCG C+ + P+ A E+ + VV Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVV 155 Score = 30.7 bits (66), Expect = 0.98 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +3 Query: 150 KLVVIDFMATWCGPCKMIGPKLDEIAAEMS--DSIVVSR 260 K V+++ A WCG C+ + P +++A + DS+V+++ Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITK 498 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGK 343 K+D E ++A EY + PT +F +G+ Sbjct: 158 KIDATEENELAQEYRVQGFPTLLFFVDGE 186 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 33.9 bits (74), Expect = 0.11 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +3 Query: 147 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVV 254 ++ V+++F A WCG C+ + P+ A E+ + VV Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVV 155 Score = 30.7 bits (66), Expect = 0.98 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +3 Query: 150 KLVVIDFMATWCGPCKMIGPKLDEIAAEMS--DSIVVSR 260 K V+++ A WCG C+ + P +++A + DS+V+++ Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITK 498 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGK 343 K+D E ++A EY + PT +F +G+ Sbjct: 158 KIDATEENELAQEYRVQGFPTLLFFVDGE 186 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 84 PKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 P S+ + S D+L T E L +++F A WCG CK + P+ + A + + Sbjct: 162 PSASVELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKV 214 Score = 32.3 bits (70), Expect = 0.32 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +3 Query: 153 LVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVVS 257 +V+++F A WCG C+ + P +++A+ + V+ Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVA 82 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 263 DVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 367 D+DEC + +I PTF F ++G+K+DE GA Sbjct: 81 DIDECPETTR--HIRYTPTFQFYRDGEKVDEMFGA 113 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +3 Query: 114 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMS 239 DD+K+ + A VI++ A+WCG C I P +++ S Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLSNSFS 73 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDE 355 FKVDV+E +A +I +PTF K G+K+ E Sbjct: 631 FKVDVEESLALAKAESIKKIPTFKIYKKGEKVKE 664 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 254 FKVDVDECEDIASEYNINSMPTFVFVKNGKKLDE 355 F VDV+E +A +I +PTF KNG K+ E Sbjct: 640 FMVDVEESMALAKAESIRKVPTFKMYKNGDKVKE 673 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 32.7 bits (71), Expect = 0.24 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 153 LVVIDFMATWCGPCKMIGPKLDEIA 227 +V+++F A WCG CK + P +++A Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVA 74 Score = 32.3 bits (70), Expect = 0.32 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +3 Query: 147 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 ++L +++F A WCG CK + P+ A + + Sbjct: 180 NELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKV 213 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 30.7 bits (66), Expect = 0.98 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 156 VVIDFMATWCGPCKMIGPKLDEIAAE 233 V++ F A WCGPC+ + P L+++ +E Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSE 255 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 30.7 bits (66), Expect = 0.98 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 105 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 242 K D+L + L ++ + LVV+DF T CG CK I ++ + D Sbjct: 104 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGD 151 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 263 DVDECEDIASEYNINSMPTFVFVKNGKKLDEFS 361 + DE ++A I ++P F F KNG L+ F+ Sbjct: 166 EYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 198 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 30.7 bits (66), Expect = 0.98 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 105 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 242 K D+L + L ++ + LVV+DF T CG CK I ++ + D Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGD 138 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 30.7 bits (66), Expect = 0.98 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 105 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 242 K D+L + L ++ + LVV+DF T CG CK I ++ + D Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGD 138 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 263 DVDECEDIASEYNINSMPTFVFVKNGKKLDEFS 361 + DE ++A I ++P F F KNG L+ F+ Sbjct: 153 EYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 185 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 29.5 bits (63), Expect = 2.3 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 147 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM 236 + +++F A WCG C+ + P+ A E+ Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATEL 145 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 150 KLVVIDFMATWCGPCKMIGPKLDEIAAEMS--DSIVVSR 260 K V+++ A WCG C+ P +++ + DS+VV++ Sbjct: 456 KDVLLEIYAPWCGHCQSFEPIYNKLGKYLKGIDSLVVAK 494 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 376 K+D D IASE I PT + NG L G++ + Sbjct: 134 KIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAE 173 >At5g17890.1 68418.m02098 LIM domain-containing protein / disease resistance protein-related low similarity to disease resistance protein RPP4 [Arabidopsis thaliana] GI:20270890; contains Pfam profiles PF00412: LIM domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1613 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 570 FLHSRGCKH*KLISSNSLQTLKHFFF 493 FL++ GCKH K I+ + Q +HF F Sbjct: 816 FLNAHGCKHLKSINLDFEQLPRHFIF 841 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 150 KLVVIDFMATWCGPCKMIGPKL 215 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 150 KLVVIDFMATWCGPCKMIGPKL 215 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At1g78740.1 68414.m09177 hypothetical protein Length = 306 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 414 SIYLCLRIVVLSLSTLA-PENSSSFLPFLTXTNVG 313 +IY+C +V L LST+ P S LPFL +G Sbjct: 94 TIYICESLVSLKLSTVTLPSVKSVSLPFLRVLKLG 128 >At5g36010.1 68418.m04337 hypothetical protein contains Pfam profile PF03778: Protein of unknown function (DUF321) Length = 221 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 456 LKKKKHVYVFNK*RKNVLTSVMNLKILIFSVCSLWNAKNI 575 L +K VYVF ++ V NL++ FS+ SL +N+ Sbjct: 179 LTRKSRVYVFGGKITDLCFLVENLRVYFFSISSLVYLRNL 218 >At4g02330.1 68417.m00317 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 573 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 432 LRTTLVSIYLCLRIVVLSLSTLAPENSSS 346 L+ LV+++L L+ + ++ TL P NSSS Sbjct: 4 LKLFLVTLFLSLQTLFIASQTLLPSNSSS 32 >At2g45060.1 68415.m05609 expressed protein Length = 272 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 266 VDECEDIASEYNINSMPTFVFVKNG 340 +D DIASEYN+ F +K+G Sbjct: 90 IDSLRDIASEYNVYEQMVFGKIKDG 114 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 27.5 bits (58), Expect = 9.2 Identities = 8/40 (20%), Positives = 23/40 (57%) Frame = +3 Query: 129 RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 248 +L +++++ + + CGPC+ + P L+++ E + + Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDEYNHDV 475 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 364 +VD + ++ I+S PTF+ NG+++ ++ G Sbjct: 82 EVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 364 +VD + ++ I+S PTF+ NG+++ ++ G Sbjct: 82 EVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +2 Query: 257 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 364 +VD + ++ I+S PTF+ NG+++ ++ G Sbjct: 82 EVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,804,111 Number of Sequences: 28952 Number of extensions: 259925 Number of successful extensions: 710 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -