BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00191 (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) 52 4e-07 SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07) 50 2e-06 SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) 48 1e-05 SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0) 39 0.004 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06) 38 0.007 SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) 37 0.015 SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0) 36 0.027 SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) 36 0.047 SB_2654| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_13486| Best HMM Match : DUF1530 (HMM E-Value=2.3) 34 0.11 SB_2655| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0) 31 0.77 SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_6126| Best HMM Match : Thioredoxin (HMM E-Value=0.021) 31 1.0 SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) 31 1.0 SB_21263| Best HMM Match : Thioredoxin (HMM E-Value=0.00093) 31 1.0 SB_17078| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_47047| Best HMM Match : DUF761 (HMM E-Value=3.2) 30 1.8 SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33) 30 2.3 SB_43665| Best HMM Match : Thioredoxin (HMM E-Value=0.019) 29 3.1 SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19) 28 9.5 >SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) Length = 456 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/51 (41%), Positives = 29/51 (56%) Frame = +2 Query: 59 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 211 I ++D + AG +LVVIDF ATWCGPCK I P ++ + D + Sbjct: 11 IVVEDDSFFSVEIERAGSRLVVIDFTATWCGPCKSIAPVFTNLSMKFMDVV 61 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 265 INSMPTFVFVKNGKKLDEFSGAN 333 I +MPTF F N K+DE GA+ Sbjct: 79 IRAMPTFHFYHNKAKIDELRGAD 101 >SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07) Length = 438 Score = 50.0 bits (114), Expect = 2e-06 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = +2 Query: 110 DKLVVIDFMATWCGPCKMIGPKLDEIAAE 196 +++ IDF ATWCGPC+MIGPK +E+A E Sbjct: 11 NEVAAIDFTATWCGPCRMIGPKFEEMAKE 39 >SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 48.4 bits (110), Expect = 6e-06 Identities = 20/44 (45%), Positives = 28/44 (63%) Frame = +2 Query: 65 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 196 I++ + + + DKLVVIDF A WCGPC+ I PK ++A E Sbjct: 15 IEERAEFNSVINNTKDKLVVIDFYAEWCGPCRQIKPKFKKMALE 58 >SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) Length = 308 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +2 Query: 47 PKMSIHIKDSDDLKT-RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 211 P+ ++ + + D T L AG KLVV DF A+WCGPCK I P ++ + ++ Sbjct: 5 PRGNVKVLELDSQFTAELTNAGTKLVVADFTASWCGPCKSIAPVYSGLSEKYKQAV 60 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 265 INSMPTFVFVKNGKKLDEFSGAN 333 + +MPTF F KN K+DE GA+ Sbjct: 78 VTAMPTFQFFKNKVKVDEVRGAD 100 >SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 1056 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/65 (30%), Positives = 33/65 (50%) Frame = +2 Query: 2 FAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLD 181 + F V F++ +S + D D + AG +++++F A WCG CK + P+ Sbjct: 519 WTFTQVSAFVLLFVGSTLSSDVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEY- 577 Query: 182 EIAAE 196 E AAE Sbjct: 578 ETAAE 582 Score = 37.9 bits (84), Expect = 0.009 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +2 Query: 113 KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 205 K V+I+F A WCG CK + PK +E+ ++ D Sbjct: 881 KDVLIEFYAPWCGHCKSLEPKYNELGEKLQD 911 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = +2 Query: 41 YLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 211 YLP + + + LA + V+DF A WCGPC PK +++A + + Sbjct: 430 YLPSIVSEVNSKNFFTDVLAS--EDAWVVDFYAPWCGPCMRFAPKYEQLAKMLKGKV 484 >SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06) Length = 70 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +2 Query: 53 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 196 +S + D D + AG +++++F A WCG CK + P+ E AAE Sbjct: 11 LSSDVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEY-ETAAE 57 >SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 536 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 95 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 205 +A DK V ++F A WCG CK + P D++ + D Sbjct: 397 VARNKDKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKD 433 Score = 35.9 bits (79), Expect = 0.036 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 98 AEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEM 199 A A +K V+++F A WCG CK + P+ + A ++ Sbjct: 37 AVAANKHVLVEFYAPWCGHCKALAPEYAKAAGQL 70 >SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 36.7 bits (81), Expect = 0.020 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +2 Query: 110 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM 199 + L++++F A WCG CK + P+ ++ A E+ Sbjct: 193 ESLMLVEFFAPWCGHCKQLAPEYEKAAQEL 222 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Frame = +2 Query: 56 SIHIKDSDDLKTRLAEAGDK------LVVIDFMATWCGPCKMIGPKLDEIAAEM 199 S +K+ DD+ ++ D+ +++++F A WCG CK + P+ + A +M Sbjct: 54 SDEVKEEDDVSVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKM 107 >SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 295 Score = 36.3 bits (80), Expect = 0.027 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 107 GDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDS 208 G+K +++F A WCG CK + P +++ + S Sbjct: 38 GEKFALVEFYAPWCGHCKQLAPTYEQLGEAYTQS 71 >SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) Length = 472 Score = 35.5 bits (78), Expect = 0.047 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 77 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEM 199 DD A K V++DF A WC CK + P ++A E+ Sbjct: 140 DDSNFEPAVQKHKFVLVDFYAPWCFHCKKMAPDYKDVAKEL 180 Score = 34.3 bits (75), Expect = 0.11 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 110 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDS 208 ++ V++DF A WC C+ + P D A ++ D+ Sbjct: 68 NEYVLVDFYAPWCSDCQRLSPLFDTAALQLRDN 100 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 256 EYNINSMPTFVFVKNGKKLDEFSGAN 333 +YN+ +PT +GK ++EF G N Sbjct: 208 KYNVKFLPTIYLFHDGKFVEEFEGNN 233 >SB_2654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 35.1 bits (77), Expect = 0.062 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 137 ATWCGPCKMIGPKLDEIAAEMSDSI 211 A WC PCK++ P+LD I AE + Sbjct: 46 ACWCNPCKVLTPRLDAIIAEQDGKV 70 >SB_13486| Best HMM Match : DUF1530 (HMM E-Value=2.3) Length = 222 Score = 34.3 bits (75), Expect = 0.11 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 95 LAEAGDKLVVIDFMATWCGPCKMIGP 172 L E+ K+ +IDF A+WC PC++ P Sbjct: 172 LKESMGKVTIIDFWASWCQPCRVENP 197 >SB_2655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 33.9 bits (74), Expect = 0.14 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 143 WCGPCKMIGPKLDEIAAEMSDSI 211 WC PCK++ P+LD I AE + Sbjct: 2 WCNPCKVLTPRLDAIIAEQDGKV 24 >SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 362 Score = 31.5 bits (68), Expect = 0.77 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 116 LVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 211 L +++F A WCG C+ + P+ + A E+ + Sbjct: 99 LWLVEFFAPWCGHCQRLAPEWAKAATELKGKV 130 >SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 31.1 bits (67), Expect = 1.0 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +2 Query: 113 KLVVIDFMATWCGPCKMIGPKLDEIAAEMS 202 +++++DF A WC C + PK ++ A +++ Sbjct: 40 EVMLVDFYAPWCSDCDNLRPKYEKAARDLA 69 >SB_6126| Best HMM Match : Thioredoxin (HMM E-Value=0.021) Length = 293 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 110 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDS 208 +K+V I F A+WC PC+ P L + E S Sbjct: 154 NKVVAIYFSASWCPPCQKFTPLLKDFYEEKIQS 186 >SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) Length = 271 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 119 VVIDFMATWCGPCKMIGPKLDEIAAEMSD 205 V++ F A WCG CK PK ++ A D Sbjct: 167 VLVMFYAPWCGHCKNAKPKYEKAAETFKD 195 >SB_21263| Best HMM Match : Thioredoxin (HMM E-Value=0.00093) Length = 148 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 86 KTRLAEAGD----KLVVIDFMATWCGPCKMIGPKLDEIAAEM 199 K L +AG+ K++ + F A WC PC+ P L + E+ Sbjct: 13 KGELVDAGEAVKGKVIAVYFSAHWCPPCRQFTPILKDFYEEL 54 >SB_17078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 437 HVFFFLIPFSFHRRLRTTLVSIY 369 H+FFF +PFS H+ + TT++ Y Sbjct: 192 HIFFFSLPFSHHQIIITTIIIKY 214 >SB_47047| Best HMM Match : DUF761 (HMM E-Value=3.2) Length = 389 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -3 Query: 192 AAISSSLGPIILHGPHQVAMKSITTSLSPASASLVFRSSESL 67 +A SS + P++ H H V+ + ++ P S++ S E L Sbjct: 338 SAQSSPINPVVYHDNHDVSTSGVKSATCPVCESVIHGSGEEL 379 >SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33) Length = 386 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 113 KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 205 K V++ F A WCG CK P+L A D Sbjct: 213 KHVLVMFYAPWCGHCKKAKPELMSAAKHHKD 243 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +2 Query: 47 PKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 205 P +H++D DD + + V++ F A WCG CK + P+ + A + + Sbjct: 81 PSEVVHLRDDMFDDFVAK-----NPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKE 130 >SB_43665| Best HMM Match : Thioredoxin (HMM E-Value=0.019) Length = 415 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 113 KLVVIDFMATWCGPCKMIGPKLDE 184 K+V + F A WC PC+ PKL E Sbjct: 30 KIVGLYFSAHWCPPCRGFTPKLVE 53 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +2 Query: 104 AGD---KLVVIDFMATWCGPCKMIGPKL 178 AGD K+V I F A WC PC+ P+L Sbjct: 168 AGDLKGKIVGIYFSAHWCPPCRAFTPEL 195 >SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19) Length = 335 Score = 27.9 bits (59), Expect = 9.5 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +2 Query: 14 TVILFLVSIYLPKMSIHIKDSDDLKTRLAEA---GDKLVVIDFMATWCGPCKMIGPKLDE 184 T +L ++I+ S+H K + + G K V I F A W C+ I D+ Sbjct: 9 TFLLISLTIFT-STSVHCKKIVEFTNENVDEYVDGSKFVFIFFYAPWDDHCQRILQIFDQ 67 Query: 185 IAAEMSD 205 +A E +D Sbjct: 68 VADEFAD 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,522,384 Number of Sequences: 59808 Number of extensions: 376019 Number of successful extensions: 1039 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1039 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -