BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00191 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 29 0.063 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.8 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.1 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 5.4 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 28.7 bits (61), Expect = 0.063 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 222 RWTLMSARTSPRVQHQLDADVRLRKEWQETGRILWR*RRQTQNNY 356 R T++ RT ++HQ D +L++ W++ I R RR+ + Y Sbjct: 8 RPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQY 52 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -2 Query: 142 GRHEVDHDELVSGF 101 G H+VD DEL++G+ Sbjct: 122 GDHDVDKDELITGW 135 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 383 LVSIYLCLRIVVLSLSTLAPE 321 LVSI +C+ +VVL++ +P+ Sbjct: 317 LVSISICVTVVVLNVHFRSPQ 337 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 383 LVSIYLCLRIVVLSLSTLAPE 321 LVSI +C+ +VVL++ +P+ Sbjct: 317 LVSISICVTVVVLNVHFRSPQ 337 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -3 Query: 732 TWISIGEIIHLSNSDKNKKKTTIHTLKFLSTPLINKKP 619 TW+ + E N K++ H + F S + K+P Sbjct: 442 TWLPVNENYKSLNLAAQKREYYSHYVAFKSLSYLKKQP 479 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,296 Number of Sequences: 438 Number of extensions: 3710 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -