BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00190-1 (423 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 4.6 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 6.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.0 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 6.0 AY045760-3|AAK84944.1| 168|Anopheles gambiae D7-related 2 prote... 22 8.0 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 22 8.0 AJ133853-1|CAB39728.1| 168|Anopheles gambiae D7-related 2 prote... 22 8.0 AJ000036-1|CAA03872.1| 150|Anopheles gambiae D7r2 protein protein. 22 8.0 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 4.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 166 STGATNGVNRPP 131 STG++N NRPP Sbjct: 1627 STGSSNSCNRPP 1638 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.0 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +2 Query: 113 CCNIWHWGSVDS 148 CC +W W ++S Sbjct: 88 CCRLWRWPDLNS 99 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 266 QSTVHNAAGH*ISVVCLCSS 207 +S +H A H + CLCSS Sbjct: 1865 RSAIHMHAAHSLFPSCLCSS 1884 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -1 Query: 309 CLASPHGVGATMAAAVNCAQCCRP 238 C S H + AT A V CA C P Sbjct: 432 CGTSGH-LAATCEAEVRCASCAGP 454 >AY045760-3|AAK84944.1| 168|Anopheles gambiae D7-related 2 protein protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 15/50 (30%), Positives = 19/50 (38%) Frame = +2 Query: 176 LSGNSGRKHSRCCTSILRKFSGRQHCAQLTAAAMVAPTP*GDAKHHPFST 325 + GN K S + R SG H A + A T D K + F T Sbjct: 70 VDGNGEVKESVLLELLQRVDSGVNHAANMKKCVTEASTSGSDKKANTFYT 119 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.2 bits (45), Expect = 8.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 352 NRKGPILERCRE 317 NR GP ERC+E Sbjct: 373 NRDGPNCERCKE 384 >AJ133853-1|CAB39728.1| 168|Anopheles gambiae D7-related 2 protein protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 15/50 (30%), Positives = 19/50 (38%) Frame = +2 Query: 176 LSGNSGRKHSRCCTSILRKFSGRQHCAQLTAAAMVAPTP*GDAKHHPFST 325 + GN K S + R SG H A + A T D K + F T Sbjct: 70 VDGNGEVKESVLLELLQRVDSGVNHAANMKKCVTEASTSGSDKKANTFYT 119 >AJ000036-1|CAA03872.1| 150|Anopheles gambiae D7r2 protein protein. Length = 150 Score = 22.2 bits (45), Expect = 8.0 Identities = 15/50 (30%), Positives = 19/50 (38%) Frame = +2 Query: 176 LSGNSGRKHSRCCTSILRKFSGRQHCAQLTAAAMVAPTP*GDAKHHPFST 325 + GN K S + R SG H A + A T D K + F T Sbjct: 70 VDGNGEVKESVLLELLQRVDSGVNHAANMKKCVTEASTSGSDKKANTFYT 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,042 Number of Sequences: 2352 Number of extensions: 8967 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -