BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00189X (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.67 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.67 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 25 0.67 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.2 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.2 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 24 1.2 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 23 1.5 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 23 1.5 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 3.6 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.7 AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 22 4.7 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 6.2 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.67 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -1 Query: 548 LSSDTVSRFYLKSTYTAVSSVLYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 390 L S TV + T VS + L G+Y ++F +V L +V + HHR Sbjct: 233 LLSLTVFLNLVAETLPQVSDAIPLL-GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.67 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -1 Query: 548 LSSDTVSRFYLKSTYTAVSSVLYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 390 L S TV + T VS + L G+Y ++F +V L +V + HHR Sbjct: 233 LLSLTVFLNLVAETLPQVSDAIPLL-GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.67 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -1 Query: 548 LSSDTVSRFYLKSTYTAVSSVLYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 390 L S TV + T VS + L G+Y ++F +V L +V + HHR Sbjct: 233 LLSLTVFLNLVAETLPQVSDAIPLL-GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 476 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 390 L G+Y ++F +V L +V + HHR Sbjct: 256 LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 476 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 390 L G+Y ++F +V L +V + HHR Sbjct: 256 LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 476 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 390 L G+Y ++F +V L +V + HHR Sbjct: 256 LIGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 23.4 bits (48), Expect = 1.5 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 318 DEHGKIHRLRRECTGE 365 DE+ +I RL+R C+G+ Sbjct: 48 DEYDEIGRLKRTCSGD 63 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 23.4 bits (48), Expect = 1.5 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 318 DEHGKIHRLRRECTGE 365 DE+ +I RL+R C+G+ Sbjct: 48 DEYDEIGRLKRTCSGD 63 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.2 bits (45), Expect = 3.6 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = -1 Query: 548 LSSDTVSRFYLKSTYTAVSSVLYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHR 390 L S TV + T VS + L G+Y ++F +V L +V HHR Sbjct: 301 LLSLTVFLNLVAETLPQVSDAIPLL-GSYFNCIMFMVASSVVLTVLVLNFHHR 352 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 4.7 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = -1 Query: 548 LSSDTVSRFYLKSTYTAVSSVLYRLEGTYLFVVVFEDHRAVTLPAVVTVLHHRHEHT 378 L S TV + T A S + L GTY ++F +V ++ HHR+ T Sbjct: 270 LLSLTVFLNMVAETMPATSDAVPLL-GTYFNCIMFMVASSVVSTILILNYHHRNADT 325 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 199 GGGWIPSGYCSPRGYVHLPA 140 GG P GY +G+VHL A Sbjct: 77 GGLEEPKGYTLFKGFVHLGA 96 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 6.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 476 LEGTYLFVVVFEDHRAVTLPAVVTVLHHR 390 L G+Y ++F +V L +V HHR Sbjct: 324 LIGSYFNCIMFMVASSVVLTVLVLNFHHR 352 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,875 Number of Sequences: 438 Number of extensions: 3164 Number of successful extensions: 15 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -