BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00182 (787 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC091472-1|AAH91472.1| 189|Homo sapiens UNQ501 protein protein. 50 7e-06 BC064948-1|AAH64948.1| 189|Homo sapiens MBC3205 protein. 50 7e-06 AY358949-1|AAQ89308.1| 189|Homo sapiens MBC3205 protein. 50 7e-06 AK223404-1|BAD97124.1| 740|Homo sapiens death-associated protei... 30 8.2 >BC091472-1|AAH91472.1| 189|Homo sapiens UNQ501 protein protein. Length = 189 Score = 50.4 bits (115), Expect = 7e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +1 Query: 406 GAQIWMTLVSGIVLYFSLPRHEFGRVQTILFPIY 507 G Q+W+T VSG +L+ SLPRH FG VQ+ LFP Y Sbjct: 24 GMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFY 57 >BC064948-1|AAH64948.1| 189|Homo sapiens MBC3205 protein. Length = 189 Score = 50.4 bits (115), Expect = 7e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +1 Query: 406 GAQIWMTLVSGIVLYFSLPRHEFGRVQTILFPIY 507 G Q+W+T VSG +L+ SLPRH FG VQ+ LFP Y Sbjct: 24 GMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFY 57 >AY358949-1|AAQ89308.1| 189|Homo sapiens MBC3205 protein. Length = 189 Score = 50.4 bits (115), Expect = 7e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +1 Query: 406 GAQIWMTLVSGIVLYFSLPRHEFGRVQTILFPIY 507 G Q+W+T VSG +L+ SLPRH FG VQ+ LFP Y Sbjct: 24 GMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFY 57 >AK223404-1|BAD97124.1| 740|Homo sapiens death-associated protein 6 variant protein. Length = 740 Score = 30.3 bits (65), Expect = 8.2 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = +2 Query: 77 PKVSRTLERMKLKHNITTDPVNEEKQREVEY---QPDLLAVSTQYTKIAYDVFKQAVVRL 247 P+V+R +ER+ K T P + R VE + L Q +A D F+ A +RL Sbjct: 265 PEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDAGIRL 324 Query: 248 QE*RH 262 QE RH Sbjct: 325 QERRH 329 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,179,745 Number of Sequences: 237096 Number of extensions: 2549792 Number of successful extensions: 10508 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10507 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9590293096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -