BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00180 (595 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 5.9 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 5.9 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 5.9 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 5.9 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 7.8 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 352 ANPGCGPKIGEL 387 A+PGCGP G L Sbjct: 388 ASPGCGPGQGGL 399 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.4 bits (43), Expect = 5.9 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +1 Query: 358 PGCGPKIGELYQKWNKPIAGVAIGVACVEV 447 P C E W KP V +G V+V Sbjct: 51 PACRLFCSEAAALWPKPTGEVHVGTTLVKV 80 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.4 bits (43), Expect = 5.9 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = +1 Query: 1 VLGMLWSDTRESLHGRHVRNLFAGDHHCASGDQRPPLHLRREH 129 ++ +WS ++ + H+ DH RPP H EH Sbjct: 229 IVRTIWSKSKLLIPVGHIPIRQCDDHR-----DRPPRHFHEEH 266 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 352 ANPGCGPKIGEL 387 A+PGCGP G L Sbjct: 388 ASPGCGPGQGGL 399 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.0 bits (42), Expect = 7.8 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -1 Query: 124 LAVGEEEDADHHLHNDDHQQKDCVRDD 44 L+ E+E+ +H L + D ++ DD Sbjct: 20 LSKKEDEEVEHRLSDRDDDDENITVDD 46 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,367 Number of Sequences: 336 Number of extensions: 2311 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -