BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00173 (796 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5064| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14) 29 3.3 SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_27401| Best HMM Match : SCP (HMM E-Value=9e-23) 29 5.7 >SB_5064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/82 (28%), Positives = 35/82 (42%) Frame = +2 Query: 209 VTNLDKIRGFPRSYNGTNSLRSSVRATTRESKYPTGSPSCLWTTATLPVTSETTASKLLP 388 V +L+ P S+ G + S + A ++SK T P+T T P Sbjct: 260 VLSLNLKMDLPESFEGPSPASSPMAAPAKKSK----------ENGTNPLTLRNTVDSSSP 309 Query: 389 SARGRSLSGALQTSPGLSTRPK 454 + GRS SGA+++S S K Sbjct: 310 VSGGRSYSGAIKSSLSSSVNSK 331 >SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14) Length = 1774 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 2/72 (2%) Frame = +2 Query: 227 IRGFPRSYNGTNSLRSSVRATTRESKYPTGSPSCLWTTATLPVTSETTASKLLPSARGRS 406 I G P S +NS ++S ATTR++ PT S + P T+ +T + +A+ + Sbjct: 935 INGAPVSKT-SNSTQNSTEATTRKTGTPTSKTSYSKQSRAEPSTTYSTCQQ-ASTAQASA 992 Query: 407 LSGAL--QTSPG 436 ++G++ +TS G Sbjct: 993 INGSITSKTSTG 1004 >SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +2 Query: 245 SYNGTNSLRSSVRATTRESKYPTGSPSCLWTTATLPVTS-ETTASKLLPSARGRSLSGAL 421 +YN T + + TT S T + TTA+L T+ ETT + L +A + + L Sbjct: 40 TYNYTIKISEKRKKTTTASLATTAPET---TTASLVTTAPETTTASLATTAPETTTASFL 96 Query: 422 QTSPGLSTRPK 454 T+P +T P+ Sbjct: 97 TTAPEATTAPE 107 >SB_27401| Best HMM Match : SCP (HMM E-Value=9e-23) Length = 1105 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = +2 Query: 281 RATTRESKYPTGSPSCLWTTATLPVTSETTASKLLPSARGRSLSGALQTSPGLSTRPK 454 +ATT + T +P + T P+TS T++ + R ++ G STR K Sbjct: 380 QATTTAATTSTAAPGNITTPTKGPITSNNTSTPTMSGGRKMPAKEPTTSTTGHSTRSK 437 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,443,501 Number of Sequences: 59808 Number of extensions: 468275 Number of successful extensions: 1347 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1345 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -