BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00163 (541 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pomb... 26 3.1 SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 25 7.2 SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces ... 25 9.5 SPBC1604.20c |tea2|klp4|kinesin-like protein Tea2|Schizosaccharo... 25 9.5 >SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 26.2 bits (55), Expect = 3.1 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +2 Query: 257 FRLSLRVARN-YGFNFFLF--CLQHGESQTSFRIFRSFVTNEKCIKTQLLIE 403 F+ ++ A N Y FNFFLF C Q ++ + FR+ V I T++L E Sbjct: 1490 FQDNINYASNRYSFNFFLFSVCFQSLLIPSTLQGFRNPVFRIMRIMTEVLTE 1541 >SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 661 Score = 25.0 bits (52), Expect = 7.2 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 6/55 (10%) Frame = +2 Query: 287 YGFNFFLF------CLQHGESQTSFRIFRSFVTNEKCIKTQLLIENNSLISTSHL 433 Y N FLF C + G+S+ R R+ + NE Q + S+I SHL Sbjct: 290 YPKNTFLFEVMARHCCEIGQSRFGARAIRACLENENATFEQQALVVASIIINSHL 344 >SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1150 Score = 24.6 bits (51), Expect = 9.5 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 296 NFFLFCLQHGESQTSFRIFRSFV 364 N F +QH ES+ SF RSFV Sbjct: 969 NEFSEFIQHLESEVSFNSLRSFV 991 >SPBC1604.20c |tea2|klp4|kinesin-like protein Tea2|Schizosaccharomyces pombe|chr 2|||Manual Length = 628 Score = 24.6 bits (51), Expect = 9.5 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +2 Query: 35 HENRGEGAFIFKSL 76 HE R EGAFI KSL Sbjct: 372 HERRKEGAFINKSL 385 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,788,745 Number of Sequences: 5004 Number of extensions: 30717 Number of successful extensions: 55 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -