BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00162 (609 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 25 0.38 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 24 1.2 AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 22 4.6 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 4.6 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 4.6 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 6.1 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 8.1 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 25.4 bits (53), Expect = 0.38 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 177 PILGAKDDVAPTSPPT 130 PIL K V+PT+PPT Sbjct: 85 PILAEKVSVSPTTPPT 100 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 301 EQQLSGLVCFELSAAHDLETLPVTCGLGNVITHL 200 E+ + GLVCF L A++++ + G + HL Sbjct: 400 EEVVLGLVCFRLKASNEINEALLKRLNGRGVIHL 433 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 523 CGGLPPQYIQLTVLCQESLLLSQKGTGPL 437 CG L +Y+ L + + LLS++ P+ Sbjct: 20 CGMLYGEYLMLDKILEAQRLLSEQNNQPV 48 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 523 CGGLPPQYIQLTVLCQESLLLSQKGTGPL 437 CG L +Y+ L + + LLS++ P+ Sbjct: 20 CGMLYGEYLMLDKILEAQRLLSEQNNQPV 48 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 523 CGGLPPQYIQLTVLCQESLLLSQKGTGPL 437 CG L +Y+ L + + LLS++ P+ Sbjct: 20 CGMLYGEYLMLDKILEAQRLLSEQNNQPV 48 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.4 bits (43), Expect = 6.1 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -3 Query: 460 SQKGTGPLICFS*SSQFRLHPQGRCCRCV*YFSAFYDHE 344 S + + P IC L G C+C F+ Y HE Sbjct: 29 SGRNSAPSICGEHGHCVNLPGVGHRCQCQPGFTGKYCHE 67 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 581 LETFIHQWSNSAVDVINKIMWRPAPT 504 LET +HQ + + + N I AP+ Sbjct: 505 LETLVHQLNTEVLHLSNAINKMKAPS 530 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,870 Number of Sequences: 336 Number of extensions: 3444 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -