BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00162 (609 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.3 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 5.4 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 7.1 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 550 PLLMSSIRSCGGLPPQYIQLTVLCQESLLLS 458 PLL ++ +PP+ ++ L +SL +S Sbjct: 1101 PLLTQTMEDVPSIPPEDVRCAALTSQSLQVS 1131 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 550 PLLMSSIRSCGGLPPQYIQLTVLCQESLLLS 458 PLL ++ +PP+ ++ L +SL +S Sbjct: 1097 PLLTQTMEDVPSIPPEDVRCAALTSQSLQVS 1127 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = -2 Query: 524 MWRPAPTVHPTDCAVPRISFTEPERY 447 +W PA +H P +PER+ Sbjct: 396 IWIPAFAIHRDSAIYPNPDSFDPERF 421 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +1 Query: 358 KQKNIKHNGNISLEDVIGIAKIMRNRSMARYLS 456 K+K I + +++ D G+ + NR+ YL+ Sbjct: 131 KKKGINNGIIVNINDASGLNLLPMNRNRPAYLA 163 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,448 Number of Sequences: 438 Number of extensions: 4299 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -