BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00160X (577 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces ... 26 3.4 SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces ... 25 6.0 >SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 26.2 bits (55), Expect = 3.4 Identities = 13/55 (23%), Positives = 25/55 (45%) Frame = -3 Query: 254 DNIFYLYNAVFSNCNTIISCYICFLVILNEMCRNKHYIYIYISVAVPAIPNTNSI 90 D+I + Y +F+ CN +C I + + +Y+S A P +P ++ Sbjct: 427 DSIGFKYGYIFAACNLCAACIIFLFAHETKGLTLEEINELYLSGAKPWMPRPENL 481 >SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces pombe|chr 3|||Manual Length = 546 Score = 25.4 bits (53), Expect = 6.0 Identities = 15/65 (23%), Positives = 28/65 (43%) Frame = -3 Query: 284 LQSCLSQITCDNIFYLYNAVFSNCNTIISCYICFLVILNEMCRNKHYIYIYISVAVPAIP 105 L S + ++I + Y +F+ CN +C I + + +YIS A P +P Sbjct: 417 LISFFTPFITNSIGFKYGYIFAACNLCAACIIFLFAHETKGLTLEEINELYISGAKPWMP 476 Query: 104 NTNSI 90 ++ Sbjct: 477 RPKNL 481 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,928,280 Number of Sequences: 5004 Number of extensions: 37111 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -