BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00160X (577 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26336| Best HMM Match : Dickkopf_N (HMM E-Value=4.2) 28 6.3 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_26336| Best HMM Match : Dickkopf_N (HMM E-Value=4.2) Length = 533 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = -3 Query: 293 PAKLQSCLSQITCDNIFYLYNAVFSNCNTIISCYICFLVILNEMCRN 153 P K+ + S + D FYL + T Y+C I E C N Sbjct: 218 PFKVATGFSGFSADQAFYLQGIMICGLTTYACRYMCSRSISPEQCAN 264 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 27.5 bits (58), Expect = 8.3 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 65 NIQFKITYKLNLCLESLAPLLRYIYIYSVC 154 ++ + Y +C+ +L+ LRYI +Y++C Sbjct: 1978 SVSLRYLYLCAICIFALSVSLRYICLYAIC 2007 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,095,697 Number of Sequences: 59808 Number of extensions: 237784 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -